BLASTP 2.0.10 [Aug-26-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= PAB1165 1764500 1764895 132 !not a gene!
         (132 letters)

Database: ./suso.pep; /banques/blast2/nr.pep
           598,487 sequences; 189,106,746 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||A71217 hypothetical protein PH2001 - Pyrococcus horikoshii ...    98  4e-20

>pir||A71217 hypothetical protein PH2001 - Pyrococcus horikoshii
           >gi|3130281|dbj|BAA31940.1| (AP000001) 147aa long
           hypothetical protein [Pyrococcus horikoshii]
           >gi|4432883|dbj|BAA31943.1| (AP000007) 147aa long
           hypothetical protein [Pyrococcus horikoshii]
           Length = 147
           
 Score = 98.3 bits (241), Expect = 4e-20
 Identities = 46/49 (93%), Positives = 48/49 (97%)

Query: 84  LLIVGGTTTGILFLGPKYLPRYLPIFGINGASAMKKSYFLANFLACLGL 132
           L+IVGGTTTGILFLGP+YLPRYLPI GINGASAMKKSYFLANFLACLGL
Sbjct: 2   LVIVGGTTTGILFLGPRYLPRYLPILGINGASAMKKSYFLANFLACLGL 50


  Database: ./suso.pep
    Posted date:  Jul 6, 2001  5:57 PM
  Number of letters in database: 840,471
  Number of sequences in database:  2977
  
  Database: /banques/blast2/nr.pep
    Posted date:  Dec 14, 2000 12:46 PM
  Number of letters in database: 188,266,275
  Number of sequences in database:  595,510
  
Lambda     K      H
   0.328    0.142    0.449 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 50898077
Number of Sequences: 2977
Number of extensions: 1969812
Number of successful extensions: 7774
Number of sequences better than 1.0e-10: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 7773
Number of HSP's gapped (non-prelim): 1
length of query: 132
length of database: 189,106,746
effective HSP length: 47
effective length of query: 85
effective length of database: 160,977,857
effective search space: 13683117845
effective search space used: 13683117845
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 40 (21.8 bits)
S2: 161 (67.1 bits)