BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1165 1764500 1764895 132 !not a gene! (132 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A71217 hypothetical protein PH2001 - Pyrococcus horikoshii ... 98 4e-20 >pir||A71217 hypothetical protein PH2001 - Pyrococcus horikoshii >gi|3130281|dbj|BAA31940.1| (AP000001) 147aa long hypothetical protein [Pyrococcus horikoshii] >gi|4432883|dbj|BAA31943.1| (AP000007) 147aa long hypothetical protein [Pyrococcus horikoshii] Length = 147 Score = 98.3 bits (241), Expect = 4e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Query: 84 LLIVGGTTTGILFLGPKYLPRYLPIFGINGASAMKKSYFLANFLACLGL 132 L+IVGGTTTGILFLGP+YLPRYLPI GINGASAMKKSYFLANFLACLGL Sbjct: 2 LVIVGGTTTGILFLGPRYLPRYLPILGINGASAMKKSYFLANFLACLGL 50 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.328 0.142 0.449 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50898077 Number of Sequences: 2977 Number of extensions: 1969812 Number of successful extensions: 7774 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 7773 Number of HSP's gapped (non-prelim): 1 length of query: 132 length of database: 189,106,746 effective HSP length: 47 effective length of query: 85 effective length of database: 160,977,857 effective search space: 13683117845 effective search space used: 13683117845 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.8 bits) S2: 161 (67.1 bits)