BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1179 (PAB1179) DE:Hypothetical protein (108 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B75029 hypothetical protein PAB1179 - Pyrococcus abyssi (st... 204 2e-52 pir||G71214 hypothetical protein PH1983 - Pyrococcus horikoshii ... 166 4e-41 >pir||B75029 hypothetical protein PAB1179 - Pyrococcus abyssi (strain Orsay) >gi|5459186|emb|CAB50672.1| (AJ248288) hypothetical protein [Pyrococcus abyssi] Length = 108 Score = 204 bits (513), Expect = 2e-52 Identities = 108/108 (100%), Positives = 108/108 (100%) Query: 1 MIPMEDVLREIIKAERDAEERIERAKEEAKAIIRKAREEARKIEEETLKKAEEEAQKLIE 60 MIPMEDVLREIIKAERDAEERIERAKEEAKAIIRKAREEARKIEEETLKKAEEEAQKLIE Sbjct: 1 MIPMEDVLREIIKAERDAEERIERAKEEAKAIIRKAREEARKIEEETLKKAEEEAQKLIE 60 Query: 61 SKKKEGEEEAKRIMSEGEAEISEILSKARDSEKFEKAVSECLKIIRGI 108 SKKKEGEEEAKRIMSEGEAEISEILSKARDSEKFEKAVSECLKIIRGI Sbjct: 61 SKKKEGEEEAKRIMSEGEAEISEILSKARDSEKFEKAVSECLKIIRGI 108 >pir||G71214 hypothetical protein PH1983 - Pyrococcus horikoshii >gi|3258427|dbj|BAA31110.1| (AP000007) 123aa long hypothetical protein [Pyrococcus horikoshii] Length = 123 Score = 166 bits (417), Expect = 4e-41 Identities = 85/108 (78%), Positives = 99/108 (90%) Query: 1 MIPMEDVLREIIKAERDAEERIERAKEEAKAIIRKAREEARKIEEETLKKAEEEAQKLIE 60 M+ ME+VLREIIKAER AEERIE+AKEEAK I+R+A+E+ARKIEEE +KKAE EAQKLIE Sbjct: 16 MVQMEEVLREIIKAERLAEERIEKAKEEAKKIVREAKEDARKIEEEIVKKAEMEAQKLIE 75 Query: 61 SKKKEGEEEAKRIMSEGEAEISEILSKARDSEKFEKAVSECLKIIRGI 108 KKKEGEEEAK+I+S GEAEISE+L+KA+ EKFE+AVSECLKIIRGI Sbjct: 76 EKKKEGEEEAKKILSSGEAEISEMLTKAKSEEKFEEAVSECLKIIRGI 123 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.305 0.125 0.299 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30818605 Number of Sequences: 2977 Number of extensions: 1192085 Number of successful extensions: 47580 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 47566 Number of HSP's gapped (non-prelim): 2 length of query: 108 length of database: 189,106,746 effective HSP length: 68 effective length of query: 40 effective length of database: 148,409,630 effective search space: 5936385200 effective search space used: 5936385200 T: 11 A: 40 X1: 16 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 43 (21.9 bits) S2: 158 (66.0 bits)