BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1184 (atpF) DE:H+-transporting ATP synthase, subunit F (atpF) (103 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E75028 h+-transporting ATP synthase, chain F (atpf) PAB1184... 201 1e-51 pir||H71213 probable H(+)-transporting ATP synthase subunit F - ... 192 9e-49 pir||T44673 H+-transporting ATP synthase, chain G [imported] - D... 141 2e-33 sp|Q57671|ATPF_METJA ATP SYNTHASE, SUBUNIT F >gi|2127953|pir||C6... 76 1e-13 pir||H69227 ATP synthase, subunit F - Methanobacterium thermoaut... 67 5e-11 >pir||E75028 h+-transporting ATP synthase, chain F (atpf) PAB1184 - Pyrococcus abyssi (strain Orsay) >gi|5459181|emb|CAB50667.1| (AJ248288) H+-transporting ATP synthase, subunit F (atpF) [Pyrococcus abyssi] Length = 103 Score = 201 bits (507), Expect = 1e-51 Identities = 103/103 (100%), Positives = 103/103 (100%) Query: 1 MKVVVMGDSDTVTGFRLAGVHEAYEFDFSELSIERARNKLKELVERDDVGIILITERLAQ 60 MKVVVMGDSDTVTGFRLAGVHEAYEFDFSELSIERARNKLKELVERDDVGIILITERLAQ Sbjct: 1 MKVVVMGDSDTVTGFRLAGVHEAYEFDFSELSIERARNKLKELVERDDVGIILITERLAQ 60 Query: 61 RIGDLPQVNLPIILQIPDKFGSIYGEELLREIVRKAVGIEIKR 103 RIGDLPQVNLPIILQIPDKFGSIYGEELLREIVRKAVGIEIKR Sbjct: 61 RIGDLPQVNLPIILQIPDKFGSIYGEELLREIVRKAVGIEIKR 103 >pir||H71213 probable H(+)-transporting ATP synthase subunit F - Pyrococcus horikoshii >gi|3258420|dbj|BAA31103.1| (AP000007) 103aa long hypothetical H(+)-transporting ATP synthase subunit F [Pyrococcus horikoshii] Length = 103 Score = 192 bits (483), Expect = 9e-49 Identities = 95/103 (92%), Positives = 101/103 (97%) Query: 1 MKVVVMGDSDTVTGFRLAGVHEAYEFDFSELSIERARNKLKELVERDDVGIILITERLAQ 60 MKVV+MGDSDTV GFRLAG+HEAYEFD SELSIERARNKLKELVERDDVGIILITERLAQ Sbjct: 1 MKVVIMGDSDTVVGFRLAGIHEAYEFDLSELSIERARNKLKELVERDDVGIILITERLAQ 60 Query: 61 RIGDLPQVNLPIILQIPDKFGSIYGEELLREIVRKAVGIEIKR 103 +IG+LPQVNLPIILQIPDKFGSIYGEELLREIVR+AVGIE+KR Sbjct: 61 KIGELPQVNLPIILQIPDKFGSIYGEELLREIVRRAVGIEVKR 103 >pir||T44673 H+-transporting ATP synthase, chain G [imported] - Desulfurococcus sp. (strain SY) >gi|2104725|gb|AAB64415.1| (U96487) V-ATPase G subunit [Desulfurococcus sp. SY] Length = 102 Score = 141 bits (352), Expect = 2e-33 Identities = 68/103 (66%), Positives = 84/103 (81%), Gaps = 1/103 (0%) Query: 1 MKVVVMGDSDTVTGFRLAGVHEAYEFDFSELSIERARNKLKELVERDDVGIILITERLAQ 60 MK+ V+GD DT GF+LAG HE Y F+ + L +ER RNKLKELVER DVGIILITER AQ Sbjct: 1 MKIAVLGDRDTALGFKLAGAHEVYAFEDTPLEMERLRNKLKELVERGDVGIILITERFAQ 60 Query: 61 RIGDLPQVNLPIILQIPDKFGSIYGEELLREIVRKAVGIEIKR 103 R+ ++P V +PIILQ+PDK GS +GEE LREIVR+A+G+E+KR Sbjct: 61 RV-EIPDVTIPIILQVPDKSGSKFGEEALREIVRRAIGVELKR 102 >sp|Q57671|ATPF_METJA ATP SYNTHASE, SUBUNIT F >gi|2127953|pir||C64327 H+-transporting ATP synthase (EC 3.6.1.34) subunit F - Methanococcus jannaschii >gi|1498994|gb|AAB98201.1| (U67477) H+-transporting ATP synthase, subunit F (atpF) [Methanococcus jannaschii] Length = 98 Score = 75.7 bits (183), Expect = 1e-13 Identities = 40/103 (38%), Positives = 67/103 (64%), Gaps = 6/103 (5%) Query: 1 MKVVVMGDSDTVTGFRLAGVHEAYEFDFSELSIERARNKLKELVERDDVGIILITERLAQ 60 MKV V+GD +T GFRLAG+ + YE E +++ + EL +++ I+ITER+A+ Sbjct: 1 MKVGVVGDRETAIGFRLAGLTDVYEVKNDEEAVKA----INELANNENIAFIIITERIAE 56 Query: 61 RIGD-LPQVNLPIILQIPDKFGSIYGEELLREIVRKAVGIEIK 102 I D L +N +I++IPDK G + + ++E++RKA+G+ +K Sbjct: 57 SIKDKLKNIN-KVIVEIPDKHGKLERIDPVKELIRKAIGVSMK 98 >pir||H69227 ATP synthase, subunit F - Methanobacterium thermoautotrophicum (strain Delta H) >gi|2622053|gb|AAB85452.1| (AE000869) ATP synthase, subunit F [Methanobacterium thermoautotrophicum] Length = 106 Score = 67.1 bits (161), Expect = 5e-11 Identities = 37/105 (35%), Positives = 62/105 (58%), Gaps = 11/105 (10%) Query: 3 VVVMGDSDTVTGFRLAGVHEAYEFDFSELSIERARNKLKELVERDDVGIILITERLAQRI 62 + V+GD DTVTGFRL GV E Y + + + E RN + RD II++TE++ + Sbjct: 5 IAVVGDRDTVTGFRLGGVREGYVVETPDEAEETIRNLI-----RDGFSIIIVTEKIGDEL 59 Query: 63 GDLPQVN-----LPIILQIPDKFGSIYGE-ELLREIVRKAVGIEI 101 + + LP+I++IPDK G E + LR+++++ +G+E+ Sbjct: 60 REFIEETTSSSALPMIIEIPDKTGPSERETDPLRDLIKRVIGVEM 104 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.322 0.144 0.390 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34478472 Number of Sequences: 2977 Number of extensions: 1227759 Number of successful extensions: 2989 Number of sequences better than 1.0e-10: 5 Number of HSP's better than 0.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 2983 Number of HSP's gapped (non-prelim): 5 length of query: 103 length of database: 189,106,746 effective HSP length: 53 effective length of query: 50 effective length of database: 157,386,935 effective search space: 7869346750 effective search space used: 7869346750 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 159 (66.3 bits)