BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1191 1733370 1733065 -102 !not a gene! (102 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G71212 hypothetical protein PH1967 - Pyrococcus horikoshii ... 99 1e-20 >pir||G71212 hypothetical protein PH1967 - Pyrococcus horikoshii >gi|3258411|dbj|BAA31094.1| (AP000007) 130aa long hypothetical protein [Pyrococcus horikoshii] Length = 130 Score = 98.7 bits (242), Expect = 1e-20 Identities = 50/73 (68%), Positives = 57/73 (77%) Query: 1 MSSSFIPGMNIVLTTERTLLSSPTIFKALTTASNVSAFAILLCFSLSAAFKLIMTRXXXX 60 +SSSFIPG+N VLTTERTLLSSPTI +ALTT SNVSAFAILLCFSLSAAFKLI+T+ Sbjct: 58 ISSSFIPGINTVLTTERTLLSSPTILRALTTCSNVSAFAILLCFSLSAAFKLIITKSKSN 117 Query: 61 XXXXXXXXREPFV 73 ++P V Sbjct: 118 FSQSSLVSKDPLV 130 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.324 0.133 0.374 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25417019 Number of Sequences: 2977 Number of extensions: 579816 Number of successful extensions: 1554 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1553 Number of HSP's gapped (non-prelim): 1 length of query: 102 length of database: 189,106,746 effective HSP length: 55 effective length of query: 47 effective length of database: 156,189,961 effective search space: 7340928167 effective search space used: 7340928167 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.6 bits) S2: 159 (66.3 bits)