BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1192 1732112 1731717 -132 !not a gene! (132 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D71212 hypothetical protein PH1964 - Pyrococcus horikoshii ... 120 1e-26 >pir||D71212 hypothetical protein PH1964 - Pyrococcus horikoshii >gi|3258408|dbj|BAA31091.1| (AP000007) 109aa long hypothetical protein [Pyrococcus horikoshii] Length = 109 Score = 120 bits (297), Expect = 1e-26 Identities = 61/106 (57%), Positives = 71/106 (66%) Query: 6 MKSSFSSNLKALTFLATSHVSLIITXXXXXXXXGFSYYLIIFHNYLTPQNRHYNLSPNLP 65 MKSSFSSNL AL FLATS VSL +T G SYYLIIFH+Y +PQ+RHYN S LP Sbjct: 1 MKSSFSSNLNALMFLATSQVSLSVTLLNNSLPPGLSYYLIIFHDYFSPQDRHYNFSFYLP 60 Query: 66 SLIGCPSCLRVKLFGLYRPLFFHVHYCKISILAFSPSLVLNPKNSS 111 I CP C RVK+F Y P FH++ ++ IL F PSLVL + SS Sbjct: 61 PFIRCPVCFRVKVFCFYSPFLFHIYNYQVGILPFFPSLVLYFEYSS 106 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.328 0.142 0.458 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51552059 Number of Sequences: 2977 Number of extensions: 1939852 Number of successful extensions: 4274 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4273 Number of HSP's gapped (non-prelim): 1 length of query: 132 length of database: 189,106,746 effective HSP length: 46 effective length of query: 86 effective length of database: 161,576,344 effective search space: 13895565584 effective search space used: 13895565584 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 161 (67.1 bits)