BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1202 1718165 1717761 -135 !not a gene! (135 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G71210 hypothetical protein PH1951 - Pyrococcus horikoshii ... 122 2e-27 >pir||G71210 hypothetical protein PH1951 - Pyrococcus horikoshii >gi|3258395|dbj|BAA31078.1| (AP000007) 117aa long hypothetical protein [Pyrococcus horikoshii] Length = 117 Score = 122 bits (303), Expect = 2e-27 Identities = 68/115 (59%), Positives = 79/115 (68%) Query: 14 LTSLDFSTKLPPGLTPKSSLNSPAWGVNTNFLFLSASRSSAIIFNPSASITMGFSTFFMN 73 +T+ FST+ +PKSSLNSPAWGV T L L S +SAII +PSAS T+GFST M Sbjct: 1 MTTFPFSTRSSGTFSPKSSLNSPAWGVKTISLPLRMSLNSAIILSPSASTTIGFSTLSMI 60 Query: 74 SRTNSLVSSLVPIPGPITTASTLSESSRANSMCSPLKLSPGTSLTIKLGSSILLA 128 TNS VSSL PIPGP+T AST S SS A +CS +K P TSLTI+ GS LLA Sbjct: 61 PLTNSFVSSLTPIPGPMTIASTFSTSSSALLICSGVKFKPSTSLTIRSGSFTLLA 115 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.313 0.126 0.344 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43672276 Number of Sequences: 2977 Number of extensions: 1521806 Number of successful extensions: 5447 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5446 Number of HSP's gapped (non-prelim): 1 length of query: 135 length of database: 189,106,746 effective HSP length: 61 effective length of query: 74 effective length of database: 152,599,039 effective search space: 11292328886 effective search space used: 11292328886 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (22.0 bits) S2: 160 (66.7 bits)