BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1209 1712200 1711883 -106 !not a gene! (106 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F71201 hypothetical protein PH1883 - Pyrococcus horikoshii ... 164 4e-40 >pir||F71201 hypothetical protein PH1883 - Pyrococcus horikoshii >gi|3258322|dbj|BAA31005.1| (AP000007) 137aa long hypothetical protein [Pyrococcus horikoshii] Length = 137 Score = 164 bits (410), Expect = 4e-40 Identities = 82/106 (77%), Positives = 87/106 (81%) Query: 1 MNPPPPLFLMSKNQLVSIPSKNIGGFTYSDIVYMYXXXXXXXXXXXXXAFWSGWVNLGLN 60 MNPPPPLFLMSKNQLVSIPSKNIGGFTYS+IVYMY AF SGWVNLGL Sbjct: 26 MNPPPPLFLMSKNQLVSIPSKNIGGFTYSEIVYMYSSFPISPLSIISLAFCSGWVNLGLK 85 Query: 61 GTINFTPAFLAALTISFPSSSVRAIGFSKSMSFPSSAALIATSLCL 106 GTI+ TPAFLAA TIS PSSSV A+GFS+S+SFPSSAALIATSLCL Sbjct: 86 GTISLTPAFLAAFTISLPSSSVSAMGFSRSISFPSSAALIATSLCL 131 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.322 0.135 0.414 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36440188 Number of Sequences: 2977 Number of extensions: 1058045 Number of successful extensions: 2040 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2039 Number of HSP's gapped (non-prelim): 1 length of query: 106 length of database: 189,106,746 effective HSP length: 50 effective length of query: 56 effective length of database: 159,182,396 effective search space: 8914214176 effective search space used: 8914214176 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 159 (66.3 bits)