BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1233 (PAB1233) DE:Hypothetical protein (102 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B75020 hypothetical protein PAB1233 - Pyrococcus abyssi (st... 211 2e-54 pir||F71206 hypothetical protein PH1920 - Pyrococcus horikoshii ... 199 6e-51 >pir||B75020 hypothetical protein PAB1233 - Pyrococcus abyssi (strain Orsay) >gi|5459114|emb|CAB50600.1| (AJ248288) hypothetical protein [Pyrococcus abyssi] Length = 102 Score = 211 bits (532), Expect = 2e-54 Identities = 102/102 (100%), Positives = 102/102 (100%) Query: 1 MNSEVIKEFLEDIGADYIELEGEIHLEPRVFYEVWKYVGEPELKTYVVEDEVVEPGEYDP 60 MNSEVIKEFLEDIGADYIELEGEIHLEPRVFYEVWKYVGEPELKTYVVEDEVVEPGEYDP Sbjct: 1 MNSEVIKEFLEDIGADYIELEGEIHLEPRVFYEVWKYVGEPELKTYVVEDEVVEPGEYDP 60 Query: 61 PEMKYTEARKIKIKKVYFETLDGVKVVTDYSDFQKILKETKA 102 PEMKYTEARKIKIKKVYFETLDGVKVVTDYSDFQKILKETKA Sbjct: 61 PEMKYTEARKIKIKKVYFETLDGVKVVTDYSDFQKILKETKA 102 >pir||F71206 hypothetical protein PH1920 - Pyrococcus horikoshii >gi|3258362|dbj|BAA31045.1| (AP000007) 102aa long hypothetical protein [Pyrococcus horikoshii] Length = 102 Score = 199 bits (501), Expect = 6e-51 Identities = 92/102 (90%), Positives = 101/102 (98%) Query: 1 MNSEVIKEFLEDIGADYIELEGEIHLEPRVFYEVWKYVGEPELKTYVVEDEVVEPGEYDP 60 MNSEVIKEFLEDIGADYIELEGEIHLEP+VFYEVWKYVGEPELKTYV+EDE+VEPGEYDP Sbjct: 1 MNSEVIKEFLEDIGADYIELEGEIHLEPKVFYEVWKYVGEPELKTYVIEDEIVEPGEYDP 60 Query: 61 PEMKYTEARKIKIKKVYFETLDGVKVVTDYSDFQKILKETKA 102 PEM+YTEA+KIKIKKVYFETLDGVKVVTD+S+FQKI+KE K+ Sbjct: 61 PEMRYTEAKKIKIKKVYFETLDGVKVVTDHSEFQKIIKEMKS 102 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.313 0.138 0.389 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41044857 Number of Sequences: 2977 Number of extensions: 1717899 Number of successful extensions: 3078 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3076 Number of HSP's gapped (non-prelim): 2 length of query: 102 length of database: 189,106,746 effective HSP length: 53 effective length of query: 49 effective length of database: 157,386,935 effective search space: 7711959815 effective search space used: 7711959815 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (21.8 bits) S2: 159 (66.3 bits)