BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1238 1672649 1672323 -109 !not a gene! (109 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G71205 hypothetical protein PH1913 - Pyrococcus horikoshii ... 141 2e-33 >pir||G71205 hypothetical protein PH1913 - Pyrococcus horikoshii >gi|3258355|dbj|BAA31038.1| (AP000007) 144aa long hypothetical protein [Pyrococcus horikoshii] Length = 144 Score = 141 bits (353), Expect = 2e-33 Identities = 74/98 (75%), Positives = 80/98 (81%) Query: 12 IVAVNGMLSIIALRNAETQDIINIASFSELMWLTIHLPTSSINPVSTSPPTIMKRPPKKN 71 +VAV G+LSIIAL NAE QDI +IASFSE+M LTIH P SSINPVSTSPPT+MK PPKKN Sbjct: 1 MVAVKGILSIIALENAEIQDIKSIASFSEVMCLTIHFPASSINPVSTSPPTMMKSPPKKN 60 Query: 72 NVAHSTFSNATSGGTLLHRSKMEAPVRATTAGSIPIVS 109 VAHSTFS ATSG TLL + M APV ATTAGSIP S Sbjct: 61 RVAHSTFSRATSGETLLQSNNMVAPVSATTAGSIPRAS 98 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.317 0.130 0.367 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40129914 Number of Sequences: 2977 Number of extensions: 1435419 Number of successful extensions: 4605 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4604 Number of HSP's gapped (non-prelim): 1 length of query: 109 length of database: 189,106,746 effective HSP length: 56 effective length of query: 53 effective length of database: 155,591,474 effective search space: 8246348122 effective search space used: 8246348122 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 159 (66.3 bits)