BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1242 1662650 1662213 -146 !not a gene! (146 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A71454 hypothetical protein PH0288 - Pyrococcus horikoshii ... 95 3e-19 >pir||A71454 hypothetical protein PH0288 - Pyrococcus horikoshii >gi|3256677|dbj|BAA29360.1| (AP000001) 110aa long hypothetical protein [Pyrococcus horikoshii] Length = 110 Score = 95.2 bits (233), Expect = 3e-19 Identities = 54/107 (50%), Positives = 66/107 (61%), Gaps = 1/107 (0%) Query: 41 PSIENMKLILLFPPPIAMISFFFMTFS-RNSSSRIAKAGVTITAFNAASPSPITRLTLSL 99 P++ENM PPI +IS FF NSSS IA AGVT+TAF AASP+PIT+L L+L Sbjct: 4 PNLENMNPNFPSSPPIDIISPFFPNILVLNSSSSIANAGVTMTAFTAASPNPITKLMLNL 63 Query: 100 LSDGRIEIDNAKNPAMVVRAAPSRALPVXXXXXXXXXXRDFPFPLSS 146 +G IE ++A+ PA+VV AAPS A PV D P LSS Sbjct: 64 FREGNIESESARKPAIVVNAAPSNAFPVSEIASSAASSGDLPLFLSS 110 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.324 0.137 0.381 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44617365 Number of Sequences: 2977 Number of extensions: 1510610 Number of successful extensions: 4904 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4902 Number of HSP's gapped (non-prelim): 1 length of query: 146 length of database: 189,106,746 effective HSP length: 56 effective length of query: 90 effective length of database: 155,591,474 effective search space: 14003232660 effective search space used: 14003232660 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.6 bits) S2: 161 (67.1 bits)