BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1286 (PAB1286) DE:Hypothetical protein (103 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F75010 hypothetical protein PAB1286 - Pyrococcus abyssi (st... 213 3e-55 pir||G71141 hypothetical protein PH0346 - Pyrococcus horikoshii ... 188 2e-47 >pir||F75010 hypothetical protein PAB1286 - Pyrococcus abyssi (strain Orsay) >gi|5459038|emb|CAB50524.1| (AJ248288) hypothetical protein [Pyrococcus abyssi] Length = 103 Score = 213 bits (538), Expect = 3e-55 Identities = 103/103 (100%), Positives = 103/103 (100%) Query: 1 MRRVKLGHHYYYIVTPEDLKNGKYKGKNVVLEGEIKEKPLIEFLPMELPSYRTTFEIFGF 60 MRRVKLGHHYYYIVTPEDLKNGKYKGKNVVLEGEIKEKPLIEFLPMELPSYRTTFEIFGF Sbjct: 1 MRRVKLGHHYYYIVTPEDLKNGKYKGKNVVLEGEIKEKPLIEFLPMELPSYRTTFEIFGF 60 Query: 61 KVEFSGTPYIKLGDKVKVYGVFVGDGIIARAIETEGAIYLTEE 103 KVEFSGTPYIKLGDKVKVYGVFVGDGIIARAIETEGAIYLTEE Sbjct: 61 KVEFSGTPYIKLGDKVKVYGVFVGDGIIARAIETEGAIYLTEE 103 >pir||G71141 hypothetical protein PH0346 - Pyrococcus horikoshii >gi|3256737|dbj|BAA29420.1| (AP000002) 103aa long hypothetical protein [Pyrococcus horikoshii] Length = 103 Score = 188 bits (472), Expect = 2e-47 Identities = 85/103 (82%), Positives = 98/103 (94%) Query: 1 MRRVKLGHHYYYIVTPEDLKNGKYKGKNVVLEGEIKEKPLIEFLPMELPSYRTTFEIFGF 60 M RVKLGHHYYYIVTP+DL++GKYKGKN+V+EGEIK+KP+IEFLPMELPSYRT F + GF Sbjct: 1 MSRVKLGHHYYYIVTPQDLRDGKYKGKNIVIEGEIKDKPIIEFLPMELPSYRTIFRVSGF 60 Query: 61 KVEFSGTPYIKLGDKVKVYGVFVGDGIIARAIETEGAIYLTEE 103 KVEFSGTP +++G+KVKVYGVFVGDGIIARAIETEGAIY+TEE Sbjct: 61 KVEFSGTPNVRMGEKVKVYGVFVGDGIIARAIETEGAIYITEE 103 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.320 0.145 0.419 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41008147 Number of Sequences: 2977 Number of extensions: 1649415 Number of successful extensions: 2976 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2974 Number of HSP's gapped (non-prelim): 2 length of query: 103 length of database: 189,106,746 effective HSP length: 49 effective length of query: 54 effective length of database: 159,780,883 effective search space: 8628167682 effective search space used: 8628167682 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 159 (66.3 bits)