BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1325 (PAB1325) DE:Hypothetical protein (147 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E75003 hypothetical protein PAB1325 - Pyrococcus abyssi (st... 284 3e-76 pir||B71159 hypothetical protein PH0471 - Pyrococcus horikoshii ... 222 1e-57 >pir||E75003 hypothetical protein PAB1325 - Pyrococcus abyssi (strain Orsay) >gi|5458981|emb|CAB50467.1| (AJ248288) hypothetical protein [Pyrococcus abyssi] Length = 147 Score = 284 bits (720), Expect = 3e-76 Identities = 147/147 (100%), Positives = 147/147 (100%) Query: 1 MMTMDALPISLLILGLLIIILDMMVSAFITPIGIAFSVLGLLLLFKVNFYLSFVISLISA 60 MMTMDALPISLLILGLLIIILDMMVSAFITPIGIAFSVLGLLLLFKVNFYLSFVISLISA Sbjct: 1 MMTMDALPISLLILGLLIIILDMMVSAFITPIGIAFSVLGLLLLFKVNFYLSFVISLISA 60 Query: 61 VLSYMAFARMIKRETRDIGREKYTFELKGKTGKVVKVSEDHYLVEVEGDRWIAYSDEELK 120 VLSYMAFARMIKRETRDIGREKYTFELKGKTGKVVKVSEDHYLVEVEGDRWIAYSDEELK Sbjct: 61 VLSYMAFARMIKRETRDIGREKYTFELKGKTGKVVKVSEDHYLVEVEGDRWIAYSDEELK 120 Query: 121 VGDTIVVEDVDGVKLKVRKAPRSRSPQ 147 VGDTIVVEDVDGVKLKVRKAPRSRSPQ Sbjct: 121 VGDTIVVEDVDGVKLKVRKAPRSRSPQ 147 >pir||B71159 hypothetical protein PH0471 - Pyrococcus horikoshii >gi|3256876|dbj|BAA29559.1| (AP000002) 143aa long hypothetical protein [Pyrococcus horikoshii] Length = 143 Score = 222 bits (560), Expect = 1e-57 Identities = 106/136 (77%), Positives = 126/136 (91%) Query: 6 ALPISLLILGLLIIILDMMVSAFITPIGIAFSVLGLLLLFKVNFYLSFVISLISAVLSYM 65 A P+SLLILGLLII+LDMM+SAFITPIGIAFSVLGLLLLF VNFYLSF++SLISAV++YM Sbjct: 6 AFPLSLLILGLLIILLDMMISAFITPIGIAFSVLGLLLLFNVNFYLSFIVSLISAVIAYM 65 Query: 66 AFARMIKRETRDIGREKYTFELKGKTGKVVKVSEDHYLVEVEGDRWIAYSDEELKVGDTI 125 AFAR+++RET DIG KYTFELKGK GKVVK++EDHYLVEVEGD+WIAYSDE+L +GD + Sbjct: 66 AFARVVRRETTDIGGGKYTFELKGKVGKVVKIAEDHYLVEVEGDKWIAYSDEKLSLGDRV 125 Query: 126 VVEDVDGVKLKVRKAP 141 +V DVDG+KLKV++ P Sbjct: 126 MVVDVDGLKLKVKRIP 141 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.325 0.143 0.393 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46701306 Number of Sequences: 2977 Number of extensions: 1742497 Number of successful extensions: 8357 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8355 Number of HSP's gapped (non-prelim): 2 length of query: 147 length of database: 189,106,746 effective HSP length: 54 effective length of query: 93 effective length of database: 156,788,448 effective search space: 14581325664 effective search space used: 14581325664 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.6 bits) S2: 161 (67.1 bits)