BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1327 1519380 1519072 -103 !not a gene! (103 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F71159 hypothetical protein PH0475 - Pyrococcus horikoshii ... 106 5e-23 >pir||F71159 hypothetical protein PH0475 - Pyrococcus horikoshii >gi|3256880|dbj|BAA29563.1| (AP000002) 140aa long hypothetical protein [Pyrococcus horikoshii] Length = 140 Score = 106 bits (263), Expect = 5e-23 Identities = 59/96 (61%), Positives = 70/96 (72%), Gaps = 1/96 (1%) Query: 6 IADIPRMRAILAKALPTAFPRAIPLFPLYEDMAETVASGSVVAMLARTSAIRNSLTPNVS 65 +A+I R+RAI A+ALPTAFP AIPL PLYE++AETV SG VVA LA T AI+NSLT S Sbjct: 1 MAEIARIRAIFARALPTAFPIAIPLLPLYEEIAETVTSGRVVATLANTRAIKNSLTLKAS 60 Query: 66 AILVAALTKMSLPFINRMSPRMNTAV-TIATSTLDP 100 AILVAA T +SLP + SP N + +I T TL P Sbjct: 61 AILVAASTNISLPLMRSRSPAENIRISSIVTPTLPP 96 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.322 0.132 0.361 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29081174 Number of Sequences: 2977 Number of extensions: 811934 Number of successful extensions: 2477 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2476 Number of HSP's gapped (non-prelim): 1 length of query: 103 length of database: 189,106,746 effective HSP length: 57 effective length of query: 46 effective length of database: 154,992,987 effective search space: 7129677402 effective search space used: 7129677402 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (22.0 bits) S2: 158 (66.0 bits)