BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1352 1488565 1488233 -111 !not a gene! (111 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G71164 hypothetical protein PH0516 - Pyrococcus horikoshii ... 136 7e-32 >pir||G71164 hypothetical protein PH0516 - Pyrococcus horikoshii >gi|3256921|dbj|BAA29604.1| (AP000002) 111aa long hypothetical protein [Pyrococcus horikoshii] Length = 111 Score = 136 bits (339), Expect = 7e-32 Identities = 72/93 (77%), Positives = 77/93 (82%) Query: 1 MASTSPIDLTPSIAIFSQFLSLSTASLIKISSPYFSFSILPSSIRFSLVGSPLNSTSGTQ 60 MASTSP DLTPSIAIF LSLS A+LI+ISSPYFS S LPSSIRFSLVGSPL TSGTQ Sbjct: 1 MASTSPRDLTPSIAIFLHLLSLSMANLIRISSPYFSLSSLPSSIRFSLVGSPLKLTSGTQ 60 Query: 61 EYPWVLPVNMSNKGSLQLILQNPNSSRNLATVV 93 EY PVN+S +GSLQLILQ P+SSRN ATVV Sbjct: 61 EYSLTFPVNISKRGSLQLILQKPSSSRNFATVV 93 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.315 0.128 0.352 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31525761 Number of Sequences: 2977 Number of extensions: 1106618 Number of successful extensions: 2825 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2824 Number of HSP's gapped (non-prelim): 1 length of query: 111 length of database: 189,106,746 effective HSP length: 59 effective length of query: 52 effective length of database: 153,796,013 effective search space: 7997392676 effective search space used: 7997392676 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.6 bits) S2: 159 (66.3 bits)