BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1365 (PAB1365) DE:Hypothetical protein (118 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D75065 hypothetical protein PAB1365 - Pyrococcus abyssi (st... 232 8e-61 pir||A71167 hypothetical protein PH0533 - Pyrococcus horikoshii ... 199 6e-51 >pir||D75065 hypothetical protein PAB1365 - Pyrococcus abyssi (strain Orsay) >gi|5458930|emb|CAB50417.1| (AJ248287) hypothetical protein [Pyrococcus abyssi] Length = 118 Score = 232 bits (586), Expect = 8e-61 Identities = 118/118 (100%), Positives = 118/118 (100%) Query: 1 MKKVVHIGLPKLSEDELIEVGEIAQKVIINYIFDHLAKSEVRDMEVTARINQGETLDLEL 60 MKKVVHIGLPKLSEDELIEVGEIAQKVIINYIFDHLAKSEVRDMEVTARINQGETLDLEL Sbjct: 1 MKKVVHIGLPKLSEDELIEVGEIAQKVIINYIFDHLAKSEVRDMEVTARINQGETLDLEL 60 Query: 61 EVYVEVPIFVKVDVESLIDEAIDRAYEVVEEYLRKLAKGKGNEGREEAEEPLEEPEEG 118 EVYVEVPIFVKVDVESLIDEAIDRAYEVVEEYLRKLAKGKGNEGREEAEEPLEEPEEG Sbjct: 61 EVYVEVPIFVKVDVESLIDEAIDRAYEVVEEYLRKLAKGKGNEGREEAEEPLEEPEEG 118 >pir||A71167 hypothetical protein PH0533 - Pyrococcus horikoshii >gi|3256939|dbj|BAA29622.1| (AP000002) 119aa long hypothetical protein [Pyrococcus horikoshii] Length = 119 Score = 199 bits (502), Expect = 6e-51 Identities = 98/110 (89%), Positives = 109/110 (99%) Query: 1 MKKVVHIGLPKLSEDELIEVGEIAQKVIINYIFDHLAKSEVRDMEVTARINQGETLDLEL 60 M+KV+HIGLPKLSE+ELIE+G+IAQ+VII+YIF+HLAKSEVRDMEVTARINQGETLDLEL Sbjct: 4 MRKVIHIGLPKLSEEELIEIGDIAQRVIIDYIFEHLAKSEVRDMEVTARINQGETLDLEL 63 Query: 61 EVYVEVPIFVKVDVESLIDEAIDRAYEVVEEYLRKLAKGKGNEGREEAEE 110 EVYVEVPIFV+VDVESLIDEAID+AYEVVE +LRKLAKGKGNEGREEAEE Sbjct: 64 EVYVEVPIFVRVDVESLIDEAIDKAYEVVERHLRKLAKGKGNEGREEAEE 113 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.311 0.137 0.358 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41501781 Number of Sequences: 2977 Number of extensions: 1518568 Number of successful extensions: 4774 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4772 Number of HSP's gapped (non-prelim): 2 length of query: 118 length of database: 189,106,746 effective HSP length: 58 effective length of query: 60 effective length of database: 154,394,500 effective search space: 9263670000 effective search space used: 9263670000 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (21.7 bits) S2: 159 (66.3 bits)