BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1442 (PAB1442) DE:Hypothetical protein (111 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F75052 hypothetical protein PAB1442 - Pyrococcus abyssi (st... 228 2e-59 pir||E71171 hypothetical protein PH0569 - Pyrococcus horikoshii ... 166 1e-40 >pir||F75052 hypothetical protein PAB1442 - Pyrococcus abyssi (strain Orsay) >gi|5458828|emb|CAB50315.1| (AJ248287) hypothetical protein [Pyrococcus abyssi] Length = 111 Score = 228 bits (574), Expect = 2e-59 Identities = 111/111 (100%), Positives = 111/111 (100%) Query: 1 MKVYYPGRKWPREYEEVLNELKNVIDPVTGESILDSGILAGLEVSGRTLKVWLKFESLAE 60 MKVYYPGRKWPREYEEVLNELKNVIDPVTGESILDSGILAGLEVSGRTLKVWLKFESLAE Sbjct: 1 MKVYYPGRKWPREYEEVLNELKNVIDPVTGESILDSGILAGLEVSGRTLKVWLKFESLAE 60 Query: 61 YNILGGAAMAYSKIAGDIIERLALTKFDNVYVYDLRGNPVGVFESRGKKHE 111 YNILGGAAMAYSKIAGDIIERLALTKFDNVYVYDLRGNPVGVFESRGKKHE Sbjct: 61 YNILGGAAMAYSKIAGDIIERLALTKFDNVYVYDLRGNPVGVFESRGKKHE 111 >pir||E71171 hypothetical protein PH0569 - Pyrococcus horikoshii >gi|3256975|dbj|BAA29658.1| (AP000002) 114aa long hypothetical protein [Pyrococcus horikoshii] Length = 114 Score = 166 bits (415), Expect = 1e-40 Identities = 76/107 (71%), Positives = 90/107 (84%) Query: 1 MKVYYPGRKWPREYEEVLNELKNVIDPVTGESILDSGILAGLEVSGRTLKVWLKFESLAE 60 +K+YY R+WP EY +VL ++K +IDPVTGESILDSG+LAGLEV G TLKVWLKFES AE Sbjct: 4 VKIYYKDREWPPEYRKVLEKMKEIIDPVTGESILDSGVLAGLEVKGDTLKVWLKFESNAE 63 Query: 61 YNILGGAAMAYSKIAGDIIERLALTKFDNVYVYDLRGNPVGVFESRG 107 YNILG AAMAYSKI GDI+E+ AL FD VYVYDL NP+G+FE++G Sbjct: 64 YNILGSAAMAYSKIVGDIMEKFALVMFDKVYVYDLGNNPIGIFENKG 110 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.317 0.140 0.406 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42606351 Number of Sequences: 2977 Number of extensions: 1503719 Number of successful extensions: 3857 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3855 Number of HSP's gapped (non-prelim): 2 length of query: 111 length of database: 189,106,746 effective HSP length: 51 effective length of query: 60 effective length of database: 158,583,909 effective search space: 9515034540 effective search space used: 9515034540 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.6 bits) S2: 160 (66.7 bits)