BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1448 1357838 1357470 -123 !not a gene! (123 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H71108 hypothetical protein PH0639 - Pyrococcus horikoshii ... 168 2e-41 >pir||H71108 hypothetical protein PH0639 - Pyrococcus horikoshii >gi|3257047|dbj|BAA29730.1| (AP000003) 117aa long hypothetical protein [Pyrococcus horikoshii] Length = 117 Score = 168 bits (422), Expect = 2e-41 Identities = 85/111 (76%), Positives = 95/111 (85%) Query: 13 EWTLREELFPDLHLNHPTIQRILNIMAEIKPATGTVTNQDIIISLTILLFIAFTPLASPT 72 EW E+LFP+LHL HP + LNI+ I PATGTVTNQ+IIIS T LLFIAFTPLA+PT Sbjct: 7 EWAFCEQLFPNLHLYHPINRSTLNIIPAIIPATGTVTNQEIIISFTTLLFIAFTPLANPT 66 Query: 73 PMTAPTTVWVVDIGIPSQDAIKTTVAAEKSIVKPLVFVSSVIFLPTVSMTL 123 P+TAPTTVWVV+IGIPSQ AIKTTVAAEKSIV PLVFV+SVIF PTVS+TL Sbjct: 67 PITAPTTVWVVEIGIPSQLAIKTTVAAEKSIVNPLVFVNSVIFFPTVSITL 117 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.323 0.137 0.408 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46896663 Number of Sequences: 2977 Number of extensions: 1754197 Number of successful extensions: 4816 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4815 Number of HSP's gapped (non-prelim): 1 length of query: 123 length of database: 189,106,746 effective HSP length: 51 effective length of query: 72 effective length of database: 158,583,909 effective search space: 11418041448 effective search space used: 11418041448 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (22.0 bits) S2: 160 (66.7 bits)