BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1466 (PAB1466) DE:Hypothetical protein (185 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F75048 hypothetical protein PAB1466 - Pyrococcus abyssi (st... 359 1e-98 pir||C71112 hypothetical protein PH0666 - Pyrococcus horikoshii ... 303 1e-81 >pir||F75048 hypothetical protein PAB1466 - Pyrococcus abyssi (strain Orsay) >gi|5458796|emb|CAB50283.1| (AJ248287) hypothetical protein [Pyrococcus abyssi] Length = 185 Score = 359 bits (912), Expect = 1e-98 Identities = 185/185 (100%), Positives = 185/185 (100%) Query: 1 MDIEVLRRLLERELSSDELTEIDEEFYKDLASFRKALELNAERHEERGEDVEKRLYLAQL 60 MDIEVLRRLLERELSSDELTEIDEEFYKDLASFRKALELNAERHEERGEDVEKRLYLAQL Sbjct: 1 MDIEVLRRLLERELSSDELTEIDEEFYKDLASFRKALELNAERHEERGEDVEKRLYLAQL 60 Query: 61 SLVQGIVREILKIRLHKIVDMAFEGVPRNLVGDEKKIFAILTAFINGEPISVEAEEKVEE 120 SLVQGIVREILKIRLHKIVDMAFEGVPRNLVGDEKKIFAILTAFINGEPISVEAEEKVEE Sbjct: 61 SLVQGIVREILKIRLHKIVDMAFEGVPRNLVGDEKKIFAILTAFINGEPISVEAEEKVEE 120 Query: 121 EVKVERKPTPGFLELYLLKIDVPRIIDEELREHGPFKAGDLVTLPRSIGNVLVKRDAADR 180 EVKVERKPTPGFLELYLLKIDVPRIIDEELREHGPFKAGDLVTLPRSIGNVLVKRDAADR Sbjct: 121 EVKVERKPTPGFLELYLLKIDVPRIIDEELREHGPFKAGDLVTLPRSIGNVLVKRDAADR 180 Query: 181 IVIRL 185 IVIRL Sbjct: 181 IVIRL 185 >pir||C71112 hypothetical protein PH0666 - Pyrococcus horikoshii >gi|3257074|dbj|BAA29757.1| (AP000003) 189aa long hypothetical protein [Pyrococcus horikoshii] Length = 189 Score = 303 bits (767), Expect = 1e-81 Identities = 153/185 (82%), Positives = 168/185 (90%) Query: 1 MDIEVLRRLLERELSSDELTEIDEEFYKDLASFRKALELNAERHEERGEDVEKRLYLAQL 60 MDIEVLRRLLERELSS+ELTEIDEEFY+DLASFRKALELNAER+EERGED+EKRLYLAQL Sbjct: 5 MDIEVLRRLLERELSSEELTEIDEEFYRDLASFRKALELNAERYEERGEDIEKRLYLAQL 64 Query: 61 SLVQGIVREILKIRLHKIVDMAFEGVPRNLVGDEKKIFAILTAFINGEPISVEAEEKVEE 120 SLVQ I REILKIRLHKIVDMAFEGVP+NLVGDEKKIFA+L+AFINGEPIS+E E + Sbjct: 65 SLVQSIAREILKIRLHKIVDMAFEGVPKNLVGDEKKIFAVLSAFINGEPISIETTEVEVK 124 Query: 121 EVKVERKPTPGFLELYLLKIDVPRIIDEELREHGPFKAGDLVTLPRSIGNVLVKRDAADR 180 E KVE K GFLELYLLK D+PRIIDE L E+GPFKAGDLVTLPRSIGNVLVKR+ A++ Sbjct: 125 EEKVESKTPSGFLELYLLKSDIPRIIDENLNEYGPFKAGDLVTLPRSIGNVLVKREVAEK 184 Query: 181 IVIRL 185 I IR+ Sbjct: 185 ITIRI 189 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.319 0.142 0.380 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63844635 Number of Sequences: 2977 Number of extensions: 2743749 Number of successful extensions: 8497 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8495 Number of HSP's gapped (non-prelim): 2 length of query: 185 length of database: 189,106,746 effective HSP length: 57 effective length of query: 128 effective length of database: 154,992,987 effective search space: 19839102336 effective search space used: 19839102336 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 162 (67.5 bits)