BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1467 1330547 1330185 -121 !not a gene! (121 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F71112 hypothetical protein PH0669 - Pyrococcus horikoshii ... 146 1e-34 >pir||F71112 hypothetical protein PH0669 - Pyrococcus horikoshii >gi|3257077|dbj|BAA29760.1| (AP000003) 122aa long hypothetical protein [Pyrococcus horikoshii] Length = 122 Score = 146 bits (364), Expect = 1e-34 Identities = 74/122 (60%), Positives = 80/122 (64%), Gaps = 1/122 (0%) Query: 1 MMNLWSPEGRRNPRTGVQIPAPPP-VHFXXXXXXXXXXXXXXXXXKGTFKSFSLRTTLTS 59 MMNLWSPEGRRNPRTGVQIPAPPP +F +GTF+S LRTTLTS Sbjct: 1 MMNLWSPEGRRNPRTGVQIPAPPPSFYFSNATLTATSAITSIGSMRGTFRSSCLRTTLTS 60 Query: 60 VQPAIMHSAPLSSSFLAIFMXXXXXXXXXXALTPSYIPFITSSCSSSLGIRTSIPYLENS 119 V PAIMHSAPLSS A+ ALTPSYIP ITS CSSS+G+ S PYLENS Sbjct: 61 VHPAIMHSAPLSSRIFAVLSSSSLPSFKFPALTPSYIPLITSFCSSSVGVMISTPYLENS 120 Query: 120 FS 121 FS Sbjct: 121 FS 122 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.320 0.132 0.398 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34527269 Number of Sequences: 2977 Number of extensions: 838596 Number of successful extensions: 1532 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1530 Number of HSP's gapped (non-prelim): 1 length of query: 121 length of database: 189,106,746 effective HSP length: 53 effective length of query: 68 effective length of database: 157,386,935 effective search space: 10702311580 effective search space used: 10702311580 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 160 (66.7 bits)