BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1565 1184178 1183852 -109 !not a gene! (109 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A75066 hypothetical protein PAB1360 - Pyrococcus abyssi (st... 113 6e-25 >pir||A75066 hypothetical protein PAB1360 - Pyrococcus abyssi (strain Orsay) >gi|5458935|emb|CAB50422.1| (AJ248287) hypothetical protein [Pyrococcus abyssi] Length = 111 Score = 113 bits (280), Expect = 6e-25 Identities = 54/108 (50%), Positives = 73/108 (67%) Query: 2 VNLDELKANAQEYLEDADYLYNKGHYNSALNLYFKALVAICDYIILRDTGKLPRNHSERF 61 +NLD+L+AN EY+E + + +G YNSAL +YFKALV ICDYII ++ P+NH ERF Sbjct: 3 INLDDLRANIDEYIEVDEMAFKRGKYNSALIMYFKALVGICDYIIKKELNLEPKNHGERF 62 Query: 62 RILKEKYPEIYDIVDFHFNNYRKAYLMRVTKEWVEVLKNDVHNLYSQL 109 IL+ YP++Y VD FN YR AY R+TK V L+N+V L ++ Sbjct: 63 SILRRYYPDLYRTVDKFFNFYRDAYERRITKREVGELRNEVLRLTDRI 110 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.322 0.140 0.415 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43005965 Number of Sequences: 2977 Number of extensions: 1669737 Number of successful extensions: 4655 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4654 Number of HSP's gapped (non-prelim): 1 length of query: 109 length of database: 189,106,746 effective HSP length: 50 effective length of query: 59 effective length of database: 159,182,396 effective search space: 9391761364 effective search space used: 9391761364 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 160 (66.7 bits)