BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1569 (PAB1569) DE:Hypothetical protein (140 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B75104 hypothetical protein PAB1569 - Pyrococcus abyssi (st... 279 8e-75 pir||E71060 hypothetical protein PH1179 - Pyrococcus horikoshii ... 85 3e-16 >pir||B75104 hypothetical protein PAB1569 - Pyrococcus abyssi (strain Orsay) >gi|5458647|emb|CAB50135.1| (AJ248286) hypothetical protein [Pyrococcus abyssi] Length = 140 Score = 279 bits (707), Expect = 8e-75 Identities = 140/140 (100%), Positives = 140/140 (100%) Query: 1 MIVHPEVQGMNQNKEQQATEPLAKFHVKVTRGGQFTFPYYTRIYYNLNIGDFVELIVRTR 60 MIVHPEVQGMNQNKEQQATEPLAKFHVKVTRGGQFTFPYYTRIYYNLNIGDFVELIVRTR Sbjct: 1 MIVHPEVQGMNQNKEQQATEPLAKFHVKVTRGGQFTFPYYTRIYYNLNIGDFVELIVRTR 60 Query: 61 KSKLRGFFIARLGDKAGVTIPSEIRTNLRIKQGDIVEIVLIKYYRLQDILGDKVKILEEL 120 KSKLRGFFIARLGDKAGVTIPSEIRTNLRIKQGDIVEIVLIKYYRLQDILGDKVKILEEL Sbjct: 61 KSKLRGFFIARLGDKAGVTIPSEIRTNLRIKQGDIVEIVLIKYYRLQDILGDKVKILEEL 120 Query: 121 ASKGYKLLTPEEEKQLLLLL 140 ASKGYKLLTPEEEKQLLLLL Sbjct: 121 ASKGYKLLTPEEEKQLLLLL 140 >pir||E71060 hypothetical protein PH1179 - Pyrococcus horikoshii >gi|3257596|dbj|BAA30279.1| (AP000005) 143aa long hypothetical protein [Pyrococcus horikoshii] Length = 143 Score = 85.0 bits (207), Expect = 3e-16 Identities = 47/132 (35%), Positives = 74/132 (55%), Gaps = 9/132 (6%) Query: 15 EQQATEPLAKFHVKVTRGGQFTFPYYTRIYYNLNIGDFVELIVRTRKS-------KLRGF 67 +Q+ EPLAKFH V GQ P R + L GD +E+IVR+ K R + Sbjct: 4 QQKTVEPLAKFHASVNIKGQLVVPVKDREVFGLKRGDILEIIVRSFDVINGKIHIKKRAY 63 Query: 68 FIARLGDKAGVTIPSEIRTNLRIKQGDIVEIVLIKYYRLQDILGDKVKILEEL--ASKGY 125 + RL K +TIP E+R L I GD VE++L+ +++ +++ +K K + +L A+ Sbjct: 64 ILVRLSSKGLITIPEEVRRELGISPGDTVEVLLVGFHKFDELVTEKGKQIAKLIQANTHM 123 Query: 126 KLLTPEEEKQLL 137 +L+T EEEK ++ Sbjct: 124 RLITSEEEKTII 135 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.322 0.143 0.397 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50525995 Number of Sequences: 2977 Number of extensions: 1866104 Number of successful extensions: 4665 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4662 Number of HSP's gapped (non-prelim): 2 length of query: 140 length of database: 189,106,746 effective HSP length: 53 effective length of query: 87 effective length of database: 157,386,935 effective search space: 13692663345 effective search space used: 13692663345 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 161 (67.1 bits)