BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1575 1174125 1173634 -164 !not a gene! (164 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G71083 hypothetical protein PH0933 - Pyrococcus horikoshii ... 120 1e-26 >pir||G71083 hypothetical protein PH0933 - Pyrococcus horikoshii >gi|3257346|dbj|BAA30029.1| (AP000004) 114aa long hypothetical protein [Pyrococcus horikoshii] Length = 114 Score = 120 bits (297), Expect = 1e-26 Identities = 68/112 (60%), Positives = 71/112 (62%) Query: 53 GLSGLYISLNRSSEALYTNSPFFTGTLFGTSSPSSILPRTLTVATISSLSNMLLPYSSTS 112 G GLYI SS+ALYTNSPF TGTLFGTSS S P LTVAT SS S L PYS S Sbjct: 3 GPFGLYILSRISSDALYTNSPFLTGTLFGTSSSPSTFPSILTVATTSSFSTKLSPYSFIS 62 Query: 113 SFIELNVLLAEESIQFTFLTPRTMPRTSSPSLFFVITNSPKDTSLLGLTENS 164 S EL +L E Q TF T T PRT SP LF V TNSPK+ GLTENS Sbjct: 63 SLKELKLLFPAERSQLTFFTLLTTPRTHSPLLFLVTTNSPKEIFSSGLTENS 114 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.317 0.130 0.353 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52347013 Number of Sequences: 2977 Number of extensions: 1879761 Number of successful extensions: 5747 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5746 Number of HSP's gapped (non-prelim): 1 length of query: 164 length of database: 189,106,746 effective HSP length: 60 effective length of query: 104 effective length of database: 153,197,526 effective search space: 15932542704 effective search space used: 15932542704 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 161 (67.1 bits)