BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1608 1101362 1101045 -106 !not a gene! (106 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G71071 hypothetical protein PH1266 - Pyrococcus horikoshii ... 134 4e-31 >pir||G71071 hypothetical protein PH1266 - Pyrococcus horikoshii >gi|3257686|dbj|BAA30369.1| (AP000005) 113aa long hypothetical protein [Pyrococcus horikoshii] Length = 113 Score = 134 bits (333), Expect = 4e-31 Identities = 67/82 (81%), Positives = 72/82 (87%), Gaps = 1/82 (1%) Query: 19 MSIFSGKGSRCFMFILLLLTLFSPAPVTRTKFLSIMSTMTHFCPALLPAIITAILPTSIA 78 MSIFSG+GSRCFMFILLLLTL SPAPVT+TKFLS+MST+THFCPALLPAIITAILPTSIA Sbjct: 1 MSIFSGRGSRCFMFILLLLTLLSPAPVTKTKFLSMMSTITHFCPALLPAIITAILPTSIA 60 Query: 79 GIHPTS-QTFSPRVADGAGWSI 99 GIHPTS F P G+ WSI Sbjct: 61 GIHPTSFSFFDPASPTGSRWSI 82 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.331 0.141 0.444 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33304437 Number of Sequences: 2977 Number of extensions: 1110164 Number of successful extensions: 3706 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3704 Number of HSP's gapped (non-prelim): 1 length of query: 106 length of database: 189,106,746 effective HSP length: 47 effective length of query: 59 effective length of database: 160,977,857 effective search space: 9497693563 effective search space used: 9497693563 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.9 bits) S2: 160 (66.7 bits)