BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1609 (PAB1609) DE:Hypothetical protein (100 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F75094 hypothetical protein PAB1609 - Pyrococcus abyssi (st... 204 2e-52 >pir||F75094 hypothetical protein PAB1609 - Pyrococcus abyssi (strain Orsay) >gi|5458571|emb|CAB50059.1| (AJ248286) hypothetical protein [Pyrococcus abyssi] Length = 100 Score = 204 bits (514), Expect = 2e-52 Identities = 100/100 (100%), Positives = 100/100 (100%) Query: 1 MFKNPLNDSPTMEPRPMIFEGDPEIPAGAEEEVEGGEETVEHFFAQSKGNTIYVSFATTD 60 MFKNPLNDSPTMEPRPMIFEGDPEIPAGAEEEVEGGEETVEHFFAQSKGNTIYVSFATTD Sbjct: 1 MFKNPLNDSPTMEPRPMIFEGDPEIPAGAEEEVEGGEETVEHFFAQSKGNTIYVSFATTD 60 Query: 61 MKITIGISHQDATLEELVKAVKELLGEFKKRKLKVQENEG 100 MKITIGISHQDATLEELVKAVKELLGEFKKRKLKVQENEG Sbjct: 61 MKITIGISHQDATLEELVKAVKELLGEFKKRKLKVQENEG 100 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.310 0.132 0.363 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39711861 Number of Sequences: 2977 Number of extensions: 1561482 Number of successful extensions: 4373 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4372 Number of HSP's gapped (non-prelim): 1 length of query: 100 length of database: 189,106,746 effective HSP length: 56 effective length of query: 44 effective length of database: 155,591,474 effective search space: 6846024856 effective search space used: 6846024856 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (21.7 bits) S2: 158 (66.0 bits)