BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1610 1096103 1095735 -123 !not a gene! (123 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F71070 hypothetical protein PH1258 - Pyrococcus horikoshii ... 168 3e-41 >pir||F71070 hypothetical protein PH1258 - Pyrococcus horikoshii >gi|3257677|dbj|BAA30360.1| (AP000005) 141aa long hypothetical protein [Pyrococcus horikoshii] Length = 141 Score = 168 bits (420), Expect = 3e-41 Identities = 81/108 (75%), Positives = 89/108 (82%) Query: 16 LTTVLGIPNSLNPIPLTVTMKLLMFLKNHILGDPLISASTPVTLLKISSLSFNCSLYFNP 75 LTTV GIPNSLNPIP TV MKLLMFLK HILG+P ISAS PV LLKISS + +CSLY NP Sbjct: 2 LTTVFGIPNSLNPIPFTVIMKLLMFLKYHILGEPFISASIPVILLKISSFNLSCSLYLNP 61 Query: 76 CQRHPPHLPKYLHFPGTLIGELFTSLKSLAIVLPNLSLVLITSTTSPG 123 C +HPPHLPK+LH PG L GE SLKSLAI+ PNLSLV +TST+SPG Sbjct: 62 CHKHPPHLPKWLHLPGILRGEGVISLKSLAIIFPNLSLVSVTSTSSPG 109 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45851705 Number of Sequences: 2977 Number of extensions: 1806473 Number of successful extensions: 3516 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3515 Number of HSP's gapped (non-prelim): 1 length of query: 123 length of database: 189,106,746 effective HSP length: 52 effective length of query: 71 effective length of database: 157,985,422 effective search space: 11216964962 effective search space used: 11216964962 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 160 (66.7 bits)