BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1614 1089472 1089128 -115 !not a gene! (115 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A71050 hypothetical protein PH1096 - Pyrococcus horikoshii ... 195 1e-49 >pir||A71050 hypothetical protein PH1096 - Pyrococcus horikoshii >gi|3257512|dbj|BAA30195.1| (AP000005) 143aa long hypothetical protein [Pyrococcus horikoshii] Length = 143 Score = 195 bits (490), Expect = 1e-49 Identities = 102/115 (88%), Positives = 106/115 (91%) Query: 1 MNPKMTPYFGSSSFTLRASMTSVLLTFPTSAFLIGISFSWSSLLRASRLPRVSAFTITPT 60 + P++TPYFG SSFTLRAS+TSVLL FPTSAFLIGISFSWSSLL ASRLPRVSAFTITPT Sbjct: 29 LKPRITPYFGFSSFTLRASITSVLLMFPTSAFLIGISFSWSSLLNASRLPRVSAFTITPT 88 Query: 61 LSVLMTTLSICSNISCLAFSTSSGVGAAITGEPARASSSPGAAIFTPAAAVTSST 115 LSVLMTTLSIC IS A STSSGVGAAITGEPARASSSPGAAIFTPAAAVTSST Sbjct: 89 LSVLMTTLSICLIISSFALSTSSGVGAAITGEPARASSSPGAAIFTPAAAVTSST 143 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.318 0.125 0.351 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37379988 Number of Sequences: 2977 Number of extensions: 1156774 Number of successful extensions: 4857 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4856 Number of HSP's gapped (non-prelim): 1 length of query: 115 length of database: 189,106,746 effective HSP length: 59 effective length of query: 56 effective length of database: 153,796,013 effective search space: 8612576728 effective search space used: 8612576728 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 159 (66.3 bits)