BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1615 1088683 1088234 -150 !not a gene! (150 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B71050 hypothetical protein PH1097 - Pyrococcus horikoshii ... 195 2e-49 >pir||B71050 hypothetical protein PH1097 - Pyrococcus horikoshii >gi|3257513|dbj|BAA30196.1| (AP000005) 133aa long hypothetical protein [Pyrococcus horikoshii] Length = 133 Score = 195 bits (491), Expect = 2e-49 Identities = 101/133 (75%), Positives = 108/133 (80%) Query: 1 MFMRKGSSSSMTHPFILSILFAATTKGVLYFLSISMLSIVCGWNPSFISTTKTARSXXXX 60 MF+R GSSSS+T P ILSIL AATT GVLY L+ISMLSIVCGW PSF S T+TA+S Sbjct: 1 MFIRNGSSSSITQPLILSILLAATTNGVLYLLNISMLSIVCGWKPSFTSITRTAKSAKLP 60 Query: 61 XXXXXXVKASCPGVSMKSSPGSFISAFQSFIKGPAIFLTTSIGTSVAPMCWVIPPASFAA 120 VKASCPGVSMKS PGS ISAFQS I+GPAIFLTTSIGTSVAPMC VIPPAS AA Sbjct: 61 PLALRLVKASCPGVSMKSKPGSLISAFQSLIRGPAIFLTTSIGTSVAPMCCVIPPASLAA 120 Query: 121 TLVFLILSSKVVL 133 T VFLILSS+VVL Sbjct: 121 TFVFLILSSRVVL 133 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.325 0.132 0.398 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42697223 Number of Sequences: 2977 Number of extensions: 1214930 Number of successful extensions: 5025 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5024 Number of HSP's gapped (non-prelim): 1 length of query: 150 length of database: 189,106,746 effective HSP length: 53 effective length of query: 97 effective length of database: 157,386,935 effective search space: 15266532695 effective search space used: 15266532695 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 161 (67.1 bits)