BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1621 (PAB1621) DE:Hypothetical protein (136 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A75092 hypothetical protein PAB1621 - Pyrococcus abyssi (st... 299 1e-80 pir||C71051 hypothetical protein PH1106 - Pyrococcus horikoshii ... 133 8e-31 >pir||A75092 hypothetical protein PAB1621 - Pyrococcus abyssi (strain Orsay) >gi|5458550|emb|CAB50038.1| (AJ248286) hypothetical protein [Pyrococcus abyssi] Length = 136 Score = 299 bits (757), Expect = 1e-80 Identities = 136/136 (100%), Positives = 136/136 (100%) Query: 1 MKGRRKRGLKTSLNNLGKCEPLLHGIYHDFHFIPDLGVGDEDNETLYPCYSISTFSHAFY 60 MKGRRKRGLKTSLNNLGKCEPLLHGIYHDFHFIPDLGVGDEDNETLYPCYSISTFSHAFY Sbjct: 1 MKGRRKRGLKTSLNNLGKCEPLLHGIYHDFHFIPDLGVGDEDNETLYPCYSISTFSHAFY 60 Query: 61 LYLIPFANLNWSFHPSSFISSKLPLSTFSTVHFQHIHPAWTRHSEECLVRAKCGVTVYKH 120 LYLIPFANLNWSFHPSSFISSKLPLSTFSTVHFQHIHPAWTRHSEECLVRAKCGVTVYKH Sbjct: 61 LYLIPFANLNWSFHPSSFISSKLPLSTFSTVHFQHIHPAWTRHSEECLVRAKCGVTVYKH 120 Query: 121 FYGQKVGKTSPRKPRG 136 FYGQKVGKTSPRKPRG Sbjct: 121 FYGQKVGKTSPRKPRG 136 >pir||C71051 hypothetical protein PH1106 - Pyrococcus horikoshii >gi|3257522|dbj|BAA30205.1| (AP000005) 115aa long hypothetical protein [Pyrococcus horikoshii] Length = 115 Score = 133 bits (332), Expect = 8e-31 Identities = 62/97 (63%), Positives = 73/97 (74%) Query: 1 MKGRRKRGLKTSLNNLGKCEPLLHGIYHDFHFIPDLGVGDEDNETLYPCYSISTFSHAFY 60 MK R+K+ LK SLNN +C+P H +YHD FI + +G E + LYPCYSIS+F H F Sbjct: 1 MKKRKKQELKISLNNFRECKPPFHRVYHDLDFISNFRMGYEYYKPLYPCYSISSFPHTFN 60 Query: 61 LYLIPFANLNWSFHPSSFISSKLPLSTFSTVHFQHIH 97 LYLIPF+NLNWSFH SS ISSK PLSTFST+H QHIH Sbjct: 61 LYLIPFSNLNWSFHLSSSISSKSPLSTFSTIHLQHIH 97 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.324 0.140 0.461 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56782084 Number of Sequences: 2977 Number of extensions: 2305799 Number of successful extensions: 3462 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3460 Number of HSP's gapped (non-prelim): 2 length of query: 136 length of database: 189,106,746 effective HSP length: 46 effective length of query: 90 effective length of database: 161,576,344 effective search space: 14541870960 effective search space used: 14541870960 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (22.0 bits) S2: 161 (67.1 bits)