BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1623 (PAB1623) DE:Hypothetical protein (149 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G75091 hypothetical protein PAB1623 - Pyrococcus abyssi (st... 305 2e-82 pir||E71051 hypothetical protein PH1108 - Pyrococcus horikoshii ... 251 3e-66 >pir||G75091 hypothetical protein PAB1623 - Pyrococcus abyssi (strain Orsay) >gi|5458548|emb|CAB50036.1| (AJ248286) hypothetical protein [Pyrococcus abyssi] Length = 149 Score = 305 bits (772), Expect = 2e-82 Identities = 149/149 (100%), Positives = 149/149 (100%) Query: 1 MLFRGKYLVKVLEINEPCKELVRGSYVVLGEDEYEIYLKIEPFMEFRREFCLVKCEGKIL 60 MLFRGKYLVKVLEINEPCKELVRGSYVVLGEDEYEIYLKIEPFMEFRREFCLVKCEGKIL Sbjct: 1 MLFRGKYLVKVLEINEPCKELVRGSYVVLGEDEYEIYLKIEPFMEFRREFCLVKCEGKIL 60 Query: 61 LSEDCKYVGEVYWVRDAIGLWRLIHGKYSESGIHLILAFVVLGILYSLLGFVKRESFWTV 120 LSEDCKYVGEVYWVRDAIGLWRLIHGKYSESGIHLILAFVVLGILYSLLGFVKRESFWTV Sbjct: 61 LSEDCKYVGEVYWVRDAIGLWRLIHGKYSESGIHLILAFVVLGILYSLLGFVKRESFWTV 120 Query: 121 TGVLLVIFLVMMDLAKAIQYFLIGYVRAS 149 TGVLLVIFLVMMDLAKAIQYFLIGYVRAS Sbjct: 121 TGVLLVIFLVMMDLAKAIQYFLIGYVRAS 149 >pir||E71051 hypothetical protein PH1108 - Pyrococcus horikoshii >gi|3257524|dbj|BAA30207.1| (AP000005) 151aa long hypothetical protein [Pyrococcus horikoshii] Length = 151 Score = 251 bits (635), Expect = 3e-66 Identities = 115/149 (77%), Positives = 136/149 (91%) Query: 1 MLFRGKYLVKVLEINEPCKELVRGSYVVLGEDEYEIYLKIEPFMEFRREFCLVKCEGKIL 60 MLFRG+YLVK+LEI EPC ELV+GSYVV+G+ EYE+ LKIEPF+EFRRE CLVKCEGK++ Sbjct: 3 MLFRGRYLVKLLEIEEPCSELVKGSYVVIGDSEYEVDLKIEPFLEFRREACLVKCEGKVI 62 Query: 61 LSEDCKYVGEVYWVRDAIGLWRLIHGKYSESGIHLILAFVVLGILYSLLGFVKRESFWTV 120 LSEDCKY+GEVYWVR+A GLWRLI GK SE G HLILAF+V+ ILYSLLGFV+ +SFWTV Sbjct: 63 LSEDCKYIGEVYWVRNAKGLWRLIQGKRSEEGFHLILAFIVMIILYSLLGFVRAKSFWTV 122 Query: 121 TGVLLVIFLVMMDLAKAIQYFLIGYVRAS 149 TGVLLVIF+++MD+ KA+QYFLIGYV+AS Sbjct: 123 TGVLLVIFIILMDIGKALQYFLIGYVKAS 151 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.330 0.149 0.458 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53598249 Number of Sequences: 2977 Number of extensions: 2142742 Number of successful extensions: 6545 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6542 Number of HSP's gapped (non-prelim): 2 length of query: 149 length of database: 189,106,746 effective HSP length: 47 effective length of query: 102 effective length of database: 160,977,857 effective search space: 16419741414 effective search space used: 16419741414 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.8 bits) S2: 162 (67.5 bits)