BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1626 1073550 1073197 -118 !not a gene! (118 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H71051 hypothetical protein PH1111 - Pyrococcus horikoshii ... 102 1e-21 >pir||H71051 hypothetical protein PH1111 - Pyrococcus horikoshii >gi|3257527|dbj|BAA30210.1| (AP000005) 135aa long hypothetical protein [Pyrococcus horikoshii] Length = 135 Score = 102 bits (253), Expect = 1e-21 Identities = 52/62 (83%), Positives = 54/62 (86%) Query: 57 IKPLSVIAIPTLHLFLLLIKYAKALLRASFALLPINVWKKYLTTLPSLTISTKTVSSSGI 116 +KPLSVIAIPTLH F LLI YAKALLRAS ALLPI VWKKYL T PSLTIST+TVSSSGI Sbjct: 1 MKPLSVIAIPTLHFFFLLIMYAKALLRASLALLPIRVWKKYLVTFPSLTISTRTVSSSGI 60 Query: 117 TE 118 E Sbjct: 61 IE 62 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.325 0.137 0.392 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24993684 Number of Sequences: 2977 Number of extensions: 592971 Number of successful extensions: 1957 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1955 Number of HSP's gapped (non-prelim): 2 length of query: 118 length of database: 189,106,746 effective HSP length: 53 effective length of query: 65 effective length of database: 157,386,935 effective search space: 10230150775 effective search space used: 10230150775 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.6 bits) S2: 160 (66.7 bits)