BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1627 1070902 1070435 -156 !not a gene! (156 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B72635 hypothetical protein APE1537 - Aeropyrum pernix (str... 74 8e-13 >pir||B72635 hypothetical protein APE1537 - Aeropyrum pernix (strain K1) >gi|5105222|dbj|BAA80536.1| (AP000061) 168aa long hypothetical protein [Aeropyrum pernix] Length = 168 Score = 74.1 bits (179), Expect = 8e-13 Identities = 42/71 (59%), Positives = 44/71 (61%), Gaps = 2/71 (2%) Query: 84 LTLTSFPRFSDIHFRIGLVQHSRWLGMTRCLIRNSALKWFLARRKFLVTTSQYLGTFEYF 143 LT T PRFS IH GLVQHS W G+TRCLI S A FLV TSQY GT E Sbjct: 2 LTRTLSPRFSAIHLSTGLVQHSTWPGITRCLIIMSPCS--AASSMFLVVTSQYRGTAESL 59 Query: 144 KAHLSFPYLKS 154 AHLSFP L+S Sbjct: 60 MAHLSFPNLRS 70 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.328 0.141 0.458 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52461548 Number of Sequences: 2977 Number of extensions: 1684569 Number of successful extensions: 3129 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3128 Number of HSP's gapped (non-prelim): 1 length of query: 156 length of database: 189,106,746 effective HSP length: 47 effective length of query: 109 effective length of database: 160,977,857 effective search space: 17546586413 effective search space used: 17546586413 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 162 (67.5 bits)