BLASTP 2.0.10 [Aug-26-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= PAB1627 1070902 1070435 -156 !not a gene!
         (156 letters)

Database: ./suso.pep; /banques/blast2/nr.pep
           598,487 sequences; 189,106,746 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||B72635 hypothetical protein APE1537 - Aeropyrum pernix (str...    74  8e-13

>pir||B72635 hypothetical protein APE1537 - Aeropyrum pernix (strain K1)
           >gi|5105222|dbj|BAA80536.1| (AP000061) 168aa long
           hypothetical protein [Aeropyrum pernix]
           Length = 168
           
 Score = 74.1 bits (179), Expect = 8e-13
 Identities = 42/71 (59%), Positives = 44/71 (61%), Gaps = 2/71 (2%)

Query: 84  LTLTSFPRFSDIHFRIGLVQHSRWLGMTRCLIRNSALKWFLARRKFLVTTSQYLGTFEYF 143
           LT T  PRFS IH   GLVQHS W G+TRCLI  S      A   FLV TSQY GT E  
Sbjct: 2   LTRTLSPRFSAIHLSTGLVQHSTWPGITRCLIIMSPCS--AASSMFLVVTSQYRGTAESL 59

Query: 144 KAHLSFPYLKS 154
            AHLSFP L+S
Sbjct: 60  MAHLSFPNLRS 70


  Database: ./suso.pep
    Posted date:  Jul 6, 2001  5:57 PM
  Number of letters in database: 840,471
  Number of sequences in database:  2977
  
  Database: /banques/blast2/nr.pep
    Posted date:  Dec 14, 2000 12:46 PM
  Number of letters in database: 188,266,275
  Number of sequences in database:  595,510
  
Lambda     K      H
   0.328    0.141    0.458 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 52461548
Number of Sequences: 2977
Number of extensions: 1684569
Number of successful extensions: 3129
Number of sequences better than 1.0e-10: 1
Number of HSP's better than  0.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 3128
Number of HSP's gapped (non-prelim): 1
length of query: 156
length of database: 189,106,746
effective HSP length: 47
effective length of query: 109
effective length of database: 160,977,857
effective search space: 17546586413
effective search space used: 17546586413
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 40 (21.7 bits)
S2: 162 (67.5 bits)