BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1631 (PAB1631) DE:Hypothetical protein (148 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D75090 hypothetical protein PAB1631 - Pyrococcus abyssi (st... 286 8e-77 pir||G71052 hypothetical protein PH1118 - Pyrococcus horikoshii ... 247 4e-65 pir||B72573 hypothetical protein APE1866 - Aeropyrum pernix (str... 84 6e-16 >pir||D75090 hypothetical protein PAB1631 - Pyrococcus abyssi (strain Orsay) >gi|5458537|emb|CAB50025.1| (AJ248286) hypothetical protein [Pyrococcus abyssi] Length = 148 Score = 286 bits (724), Expect = 8e-77 Identities = 148/148 (100%), Positives = 148/148 (100%) Query: 1 MPKLMTGFVRASGYANKVRRVLFAVTRGKVEPEEVVRAAAEVNKAIFEKLQELGVKKEDV 60 MPKLMTGFVRASGYANKVRRVLFAVTRGKVEPEEVVRAAAEVNKAIFEKLQELGVKKEDV Sbjct: 1 MPKLMTGFVRASGYANKVRRVLFAVTRGKVEPEEVVRAAAEVNKAIFEKLQELGVKKEDV 60 Query: 61 VRISIEFDIVDGKISWEYDTLNIEVYRKEEEEKLALAMEEVEEMERTLEEVVMELENLAN 120 VRISIEFDIVDGKISWEYDTLNIEVYRKEEEEKLALAMEEVEEMERTLEEVVMELENLAN Sbjct: 61 VRISIEFDIVDGKISWEYDTLNIEVYRKEEEEKLALAMEEVEEMERTLEEVVMELENLAN 120 Query: 121 KLKEVTDSILSLVERIKQEHTGLKLKGE 148 KLKEVTDSILSLVERIKQEHTGLKLKGE Sbjct: 121 KLKEVTDSILSLVERIKQEHTGLKLKGE 148 >pir||G71052 hypothetical protein PH1118 - Pyrococcus horikoshii >gi|3257534|dbj|BAA30217.1| (AP000005) 247aa long hypothetical protein [Pyrococcus horikoshii] Length = 247 Score = 247 bits (624), Expect = 4e-65 Identities = 124/148 (83%), Positives = 139/148 (93%) Query: 1 MPKLMTGFVRASGYANKVRRVLFAVTRGKVEPEEVVRAAAEVNKAIFEKLQELGVKKEDV 60 +PKLM+GFVRASGYANKVRRVLFAVTRGKV PEEVVRA+AE+NK IFEKLQE+GVKKEDV Sbjct: 100 VPKLMSGFVRASGYANKVRRVLFAVTRGKVPPEEVVRASAEINKTIFEKLQEMGVKKEDV 159 Query: 61 VRISIEFDIVDGKISWEYDTLNIEVYRKEEEEKLALAMEEVEEMERTLEEVVMELENLAN 120 VRI+ +FDI DGKI W+ +TL IEVY+KEEEEKLALAMEEVE+ME+TLEEV+ ELE LAN Sbjct: 160 VRIAFDFDIEDGKILWKPETLKIEVYKKEEEEKLALAMEEVEQMEKTLEEVIGELEGLAN 219 Query: 121 KLKEVTDSILSLVERIKQEHTGLKLKGE 148 KLKEVTD+I+SLVERIKQEHTGLKLKGE Sbjct: 220 KLKEVTDAIVSLVERIKQEHTGLKLKGE 247 >pir||B72573 hypothetical protein APE1866 - Aeropyrum pernix (strain K1) >gi|5105558|dbj|BAA80871.1| (AP000062) 239aa long hypothetical protein [Aeropyrum pernix] Length = 239 Score = 84.3 bits (205), Expect = 6e-16 Identities = 48/119 (40%), Positives = 76/119 (63%), Gaps = 7/119 (5%) Query: 1 MPKLMTGFVRASGYANKVRRVLFAVTR-----GKVEPEEVVRAAAEVNKAIFEKL-QELG 54 +P L TG V A+GYA+KVRRVLFA R G++ ++V AA +N+ +FE L +L Sbjct: 6 LPTLRTGLVIAAGYADKVRRVLFAQLRDAIKSGELSNKDVAMAAGNLNRVLFELLVNKLK 65 Query: 55 VKKEDVVRISIEFDIVDGKISWEYDTLNIEVYRKEEEEKLALAMEE-VEEMERTLEEVV 112 K DVVRI I++++ D +I +++ TL +E++R+ EE++A +E+ R LEE + Sbjct: 66 ADKLDVVRIQIDYEVRDSQIQFDFSTLRVELWRRVPEEEIAPIVEDFARAAPRLLEEEI 124 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.313 0.133 0.342 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46848472 Number of Sequences: 2977 Number of extensions: 1763425 Number of successful extensions: 20042 Number of sequences better than 1.0e-10: 3 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 20039 Number of HSP's gapped (non-prelim): 3 length of query: 148 length of database: 189,106,746 effective HSP length: 62 effective length of query: 86 effective length of database: 152,000,552 effective search space: 13072047472 effective search space used: 13072047472 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (21.9 bits) S2: 161 (67.1 bits)