BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1650 (PAB1650) DE:Hypothetical protein (127 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G75086 hypothetical protein PAB1650 - Pyrococcus abyssi (st... 254 2e-67 pir||C71054 hypothetical protein PH1129 - Pyrococcus horikoshii ... 203 6e-52 >pir||G75086 hypothetical protein PAB1650 - Pyrococcus abyssi (strain Orsay) >gi|5458508|emb|CAB49996.1| (AJ248286) hypothetical protein [Pyrococcus abyssi] Length = 127 Score = 254 bits (643), Expect = 2e-67 Identities = 127/127 (100%), Positives = 127/127 (100%) Query: 1 MIERLRIREELTEEQYSKVLKVIERMKSKFPTSFSRKTKTGEKISFIDTNICGGLNFDIL 60 MIERLRIREELTEEQYSKVLKVIERMKSKFPTSFSRKTKTGEKISFIDTNICGGLNFDIL Sbjct: 1 MIERLRIREELTEEQYSKVLKVIERMKSKFPTSFSRKTKTGEKISFIDTNICGGLNFDIL 60 Query: 61 VGVREKPFVVVEVEGKKAMMAFGIMKYLLEEAGVEYSPECDGSEAYAELKKVMKAKNLFD 120 VGVREKPFVVVEVEGKKAMMAFGIMKYLLEEAGVEYSPECDGSEAYAELKKVMKAKNLFD Sbjct: 61 VGVREKPFVVVEVEGKKAMMAFGIMKYLLEEAGVEYSPECDGSEAYAELKKVMKAKNLFD 120 Query: 121 FLGGQTY 127 FLGGQTY Sbjct: 121 FLGGQTY 127 >pir||C71054 hypothetical protein PH1129 - Pyrococcus horikoshii >gi|3257546|dbj|BAA30229.1| (AP000005) 131aa long hypothetical protein [Pyrococcus horikoshii] Length = 131 Score = 203 bits (511), Expect = 6e-52 Identities = 96/122 (78%), Positives = 114/122 (92%) Query: 1 MIERLRIREELTEEQYSKVLKVIERMKSKFPTSFSRKTKTGEKISFIDTNICGGLNFDIL 60 MIERLRIREEL EEQY+KV+ VIE++KSKFPT FSR+TKTGEKISFI+T+ICGGLNFDIL Sbjct: 1 MIERLRIREELDEEQYTKVITVIEKLKSKFPTVFSRRTKTGEKISFIETSICGGLNFDIL 60 Query: 61 VGVREKPFVVVEVEGKKAMMAFGIMKYLLEEAGVEYSPECDGSEAYAELKKVMKAKNLFD 120 +G RE+PFVVVEVEG+KA AFGIMK+L+EEAGVEYSPECDG++AY ELK+++KA+NL D Sbjct: 61 IGKRERPFVVVEVEGRKAASAFGIMKFLMEEAGVEYSPECDGNQAYFELKRLVKARNLLD 120 Query: 121 FL 122 FL Sbjct: 121 FL 122 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.319 0.138 0.378 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42988061 Number of Sequences: 2977 Number of extensions: 1580512 Number of successful extensions: 4269 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4267 Number of HSP's gapped (non-prelim): 2 length of query: 127 length of database: 189,106,746 effective HSP length: 55 effective length of query: 72 effective length of database: 156,189,961 effective search space: 11245677192 effective search space used: 11245677192 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)