BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1661 (PAB1661) DE:Hypothetical protein (257 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F75084 hypothetical protein PAB1661 - Pyrococcus abyssi (st... 518 e-146 >pir||F75084 hypothetical protein PAB1661 - Pyrococcus abyssi (strain Orsay) >gi|5458491|emb|CAB49979.1| (AJ248286) hypothetical protein [Pyrococcus abyssi] Length = 257 Score = 518 bits (1320), Expect = e-146 Identities = 257/257 (100%), Positives = 257/257 (100%) Query: 1 MKEKKIKLLNLSSHKLAWWVLMRRVKVLALISSILIMVATIISWVITQDVNITLALLTLA 60 MKEKKIKLLNLSSHKLAWWVLMRRVKVLALISSILIMVATIISWVITQDVNITLALLTLA Sbjct: 1 MKEKKIKLLNLSSHKLAWWVLMRRVKVLALISSILIMVATIISWVITQDVNITLALLTLA 60 Query: 61 STIATVIMAVTIYELDIAIKELNFETVSTIYEMIDDTLKKQIQEIKSWRSQGISIEDFLE 120 STIATVIMAVTIYELDIAIKELNFETVSTIYEMIDDTLKKQIQEIKSWRSQGISIEDFLE Sbjct: 61 STIATVIMAVTIYELDIAIKELNFETVSTIYEMIDDTLKKQIQEIKSWRSQGISIEDFLE 120 Query: 121 DQRKRKIVKEASKTLNRIGYFVYREFIGEWFIQEQYAGLILDSYLAMLPYLKAFRDSSEC 180 DQRKRKIVKEASKTLNRIGYFVYREFIGEWFIQEQYAGLILDSYLAMLPYLKAFRDSSEC Sbjct: 121 DQRKRKIVKEASKTLNRIGYFVYREFIGEWFIQEQYAGLILDSYLAMLPYLKAFRDSSEC 180 Query: 181 KKRSLNEKEVDICKKSPWFIRRFYLLLVVISYHYFCKNFPAQCKAIFNSYKLEPKNPVPE 240 KKRSLNEKEVDICKKSPWFIRRFYLLLVVISYHYFCKNFPAQCKAIFNSYKLEPKNPVPE Sbjct: 181 KKRSLNEKEVDICKKSPWFIRRFYLLLVVISYHYFCKNFPAQCKAIFNSYKLEPKNPVPE 240 Query: 241 QWLENDVKRWLKRRGYL 257 QWLENDVKRWLKRRGYL Sbjct: 241 QWLENDVKRWLKRRGYL 257 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.324 0.138 0.412 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89272646 Number of Sequences: 2977 Number of extensions: 3349213 Number of successful extensions: 13672 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 13669 Number of HSP's gapped (non-prelim): 1 length of query: 257 length of database: 189,106,746 effective HSP length: 53 effective length of query: 204 effective length of database: 157,386,935 effective search space: 32106934740 effective search space used: 32106934740 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.6 bits) S2: 164 (68.3 bits)