BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1672 (PAB1672) DE:Hypothetical protein (143 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E75082 hypothetical protein PAB1672 - Pyrococcus abyssi (st... 274 3e-73 gi|11499772 conserved hypothetical protein [Archaeoglobus fulgid... 143 6e-34 >pir||E75082 hypothetical protein PAB1672 - Pyrococcus abyssi (strain Orsay) >gi|5458474|emb|CAB49962.1| (AJ248286) hypothetical protein [Pyrococcus abyssi] Length = 143 Score = 274 bits (694), Expect = 3e-73 Identities = 143/143 (100%), Positives = 143/143 (100%) Query: 1 MGRILMRFIDSNIFLYAMIKPKGNISKMILERKERSKRILLRVENGEDVVTTVVHLSEVA 60 MGRILMRFIDSNIFLYAMIKPKGNISKMILERKERSKRILLRVENGEDVVTTVVHLSEVA Sbjct: 1 MGRILMRFIDSNIFLYAMIKPKGNISKMILERKERSKRILLRVENGEDVVTTVVHLSEVA 60 Query: 61 NILEAKVSLTTAIKFLESLFLAENVKILPVSAEDYLKAILLSKEKRISVNDALAYLKMKE 120 NILEAKVSLTTAIKFLESLFLAENVKILPVSAEDYLKAILLSKEKRISVNDALAYLKMKE Sbjct: 61 NILEAKVSLTTAIKFLESLFLAENVKILPVSAEDYLKAILLSKEKRISVNDALAYLKMKE 120 Query: 121 LGIKEIYTFDRHFYNLDVKVVQE 143 LGIKEIYTFDRHFYNLDVKVVQE Sbjct: 121 LGIKEIYTFDRHFYNLDVKVVQE 143 >gi|11499772 conserved hypothetical protein [Archaeoglobus fulgidus] >gi|7483221|pir||F69523 conserved hypothetical protein AF2190 - Archaeoglobus fulgidus >gi|2648337|gb|AAB89064.1| (AE000954) conserved hypothetical protein [Archaeoglobus fulgidus] Length = 136 Score = 143 bits (358), Expect = 6e-34 Identities = 71/136 (52%), Positives = 96/136 (70%) Query: 6 MRFIDSNIFLYAMIKPKGNISKMILERKERSKRILLRVENGEDVVTTVVHLSEVANILEA 65 MRF+DSN+ +YA++KPK I E K +S IL R++ GE V TTVVHLSEVAN++ + Sbjct: 1 MRFVDSNVLIYALLKPKKEPDDRIAEMKGKSVEILRRIQEGEKVATTVVHLSEVANVIAS 60 Query: 66 KVSLTTAIKFLESLFLAENVKILPVSAEDYLKAILLSKEKRISVNDALAYLKMKELGIKE 125 + + + +F++ NVK+ VSAEDYLKA LL+ EK + VNDALAY+KM+E I+E Sbjct: 61 RSNEKLSAEFVKEFLTLRNVKVFEVSAEDYLKASLLAVEKGVDVNDALAYVKMREHKIEE 120 Query: 126 IYTFDRHFYNLDVKVV 141 IYTFD+HF + V VV Sbjct: 121 IYTFDKHFVKMGVVVV 136 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.322 0.139 0.362 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42041108 Number of Sequences: 2977 Number of extensions: 1384445 Number of successful extensions: 5050 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5048 Number of HSP's gapped (non-prelim): 2 length of query: 143 length of database: 189,106,746 effective HSP length: 58 effective length of query: 85 effective length of database: 154,394,500 effective search space: 13123532500 effective search space used: 13123532500 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 161 (67.1 bits)