BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1685 (PAB1685) DE:Hypothetical protein (125 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D75079 hypothetical protein PAB1685 - Pyrococcus abyssi (st... 252 8e-67 pir||C71082 hypothetical protein PH0921 - Pyrococcus horikoshii ... 145 1e-34 >pir||D75079 hypothetical protein PAB1685 - Pyrococcus abyssi (strain Orsay) >gi|5458449|emb|CAB49937.1| (AJ248286) hypothetical protein [Pyrococcus abyssi] Length = 125 Score = 252 bits (638), Expect = 8e-67 Identities = 125/125 (100%), Positives = 125/125 (100%) Query: 1 MEFLLLFMVSNMEGYGEIINMLRFFVRIKNFGYVDRIGNALTPEPVEIALHEAMRAFRSI 60 MEFLLLFMVSNMEGYGEIINMLRFFVRIKNFGYVDRIGNALTPEPVEIALHEAMRAFRSI Sbjct: 1 MEFLLLFMVSNMEGYGEIINMLRFFVRIKNFGYVDRIGNALTPEPVEIALHEAMRAFRSI 60 Query: 61 WEGAKTDEEGRRYIEKDGEKIYLPKIPSDTEIESFLNEVRRDIRIAKRVATLALAYPKER 120 WEGAKTDEEGRRYIEKDGEKIYLPKIPSDTEIESFLNEVRRDIRIAKRVATLALAYPKER Sbjct: 61 WEGAKTDEEGRRYIEKDGEKIYLPKIPSDTEIESFLNEVRRDIRIAKRVATLALAYPKER 120 Query: 121 KERGE 125 KERGE Sbjct: 121 KERGE 125 >pir||C71082 hypothetical protein PH0921 - Pyrococcus horikoshii >gi|3257334|dbj|BAA30017.1| (AP000004) 121aa long hypothetical protein [Pyrococcus horikoshii] Length = 121 Score = 145 bits (363), Expect = 1e-34 Identities = 70/110 (63%), Positives = 85/110 (76%) Query: 15 YGEIINMLRFFVRIKNFGYVDRIGNALTPEPVEIALHEAMRAFRSIWEGAKTDEEGRRYI 74 Y I+ MLRFFV++KNF YVDRIGNAL PE VE+AL E +RAFRS+ E A D+EGRRY+ Sbjct: 9 YEGIVKMLRFFVQMKNFSYVDRIGNALNPETVEVALFETIRAFRSVRESASIDKEGRRYV 68 Query: 75 EKDGEKIYLPKIPSDTEIESFLNEVRRDIRIAKRVATLALAYPKERKERG 124 EKDG KI +P IP D E+E FL +VR +I +AK VATLALAYP +R+ G Sbjct: 69 EKDGNKILVPGIPRDEEVEKFLEDVRSNIGVAKLVATLALAYPSKRENSG 118 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.322 0.141 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44024515 Number of Sequences: 2977 Number of extensions: 1679008 Number of successful extensions: 5016 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5014 Number of HSP's gapped (non-prelim): 2 length of query: 125 length of database: 189,106,746 effective HSP length: 52 effective length of query: 73 effective length of database: 157,985,422 effective search space: 11532935806 effective search space used: 11532935806 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 160 (66.7 bits)