BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1698 (PAB1698) DE:Hypothetical protein (102 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F75077 hypothetical protein PAB1698 - Pyrococcus abyssi (st... 202 7e-52 pir||C71067 hypothetical protein PH1233 - Pyrococcus horikoshii ... 161 3e-39 >pir||F75077 hypothetical protein PAB1698 - Pyrococcus abyssi (strain Orsay) >gi|5458435|emb|CAB49923.1| (AJ248286) hypothetical protein [Pyrococcus abyssi] Length = 102 Score = 202 bits (509), Expect = 7e-52 Identities = 102/102 (100%), Positives = 102/102 (100%) Query: 1 MLGFFRRKKKEEEEKITGKPVGKVKVENILIVGFKTVIICEVLEGMVKVGYKVRKGKKVA 60 MLGFFRRKKKEEEEKITGKPVGKVKVENILIVGFKTVIICEVLEGMVKVGYKVRKGKKVA Sbjct: 1 MLGFFRRKKKEEEEKITGKPVGKVKVENILIVGFKTVIICEVLEGMVKVGYKVRKGKKVA 60 Query: 61 GIVSMEREHKKVEFAIPGDKIGIMLEKNIGAEKGDILEVFIV 102 GIVSMEREHKKVEFAIPGDKIGIMLEKNIGAEKGDILEVFIV Sbjct: 61 GIVSMEREHKKVEFAIPGDKIGIMLEKNIGAEKGDILEVFIV 102 >pir||C71067 hypothetical protein PH1233 - Pyrococcus horikoshii >gi|3257650|dbj|BAA30333.1| (AP000005) 101aa long hypothetical protein [Pyrococcus horikoshii] Length = 101 Score = 161 bits (402), Expect = 3e-39 Identities = 79/102 (77%), Positives = 93/102 (90%), Gaps = 1/102 (0%) Query: 1 MLGFFRRKKKEEEEKITGKPVGKVKVENILIVGFKTVIICEVLEGMVKVGYKVRKGKKVA 60 M FF+RK E+E+ +TGKPVGKVKVE+IL VGF+ VIICEVLEG+VKVGYKV+KGKKVA Sbjct: 1 MFKFFKRKG-EDEKDVTGKPVGKVKVESILKVGFRDVIICEVLEGIVKVGYKVKKGKKVA 59 Query: 61 GIVSMEREHKKVEFAIPGDKIGIMLEKNIGAEKGDILEVFIV 102 GIVSMEREHKK+EFAIPGD++G+MLEKNI AEK DILEV++V Sbjct: 60 GIVSMEREHKKIEFAIPGDRVGMMLEKNINAEKDDILEVYLV 101 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.320 0.144 0.392 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35805118 Number of Sequences: 2977 Number of extensions: 1302560 Number of successful extensions: 4602 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4600 Number of HSP's gapped (non-prelim): 2 length of query: 102 length of database: 189,106,746 effective HSP length: 53 effective length of query: 49 effective length of database: 157,386,935 effective search space: 7711959815 effective search space used: 7711959815 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 159 (66.3 bits)