BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1705 (PAB1705) DE:Hypothetical protein (155 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H75075 hypothetical protein PAB1705 - Pyrococcus abyssi (st... 312 1e-84 pir||E71068 hypothetical protein PH1243 - Pyrococcus horikoshii ... 276 1e-73 >pir||H75075 hypothetical protein PAB1705 - Pyrococcus abyssi (strain Orsay) >gi|5458421|emb|CAB49909.1| (AJ248286) hypothetical protein [Pyrococcus abyssi] Length = 155 Score = 312 bits (792), Expect = 1e-84 Identities = 155/155 (100%), Positives = 155/155 (100%) Query: 1 MKVEGLVSSLRNAETIEELFSILKKKGAPVIDFEGMKKLIIIEGDFEGKQFYTEINGMKA 60 MKVEGLVSSLRNAETIEELFSILKKKGAPVIDFEGMKKLIIIEGDFEGKQFYTEINGMKA Sbjct: 1 MKVEGLVSSLRNAETIEELFSILKKKGAPVIDFEGMKKLIIIEGDFEGKQFYTEINGMKA 60 Query: 61 NLVLGDAMLNSANVPFKCKKPFTGGNLILVDFDNVESEEFVLAYKNETGVYFHVKNGEPR 120 NLVLGDAMLNSANVPFKCKKPFTGGNLILVDFDNVESEEFVLAYKNETGVYFHVKNGEPR Sbjct: 61 NLVLGDAMLNSANVPFKCKKPFTGGNLILVDFDNVESEEFVLAYKNETGVYFHVKNGEPR 120 Query: 121 EISREEYEELKDKMPEFKVKGLSEEEAESMGAFFG 155 EISREEYEELKDKMPEFKVKGLSEEEAESMGAFFG Sbjct: 121 EISREEYEELKDKMPEFKVKGLSEEEAESMGAFFG 155 >pir||E71068 hypothetical protein PH1243 - Pyrococcus horikoshii >gi|3257660|dbj|BAA30343.1| (AP000005) 155aa long hypothetical protein [Pyrococcus horikoshii] Length = 155 Score = 276 bits (698), Expect = 1e-73 Identities = 133/155 (85%), Positives = 146/155 (93%) Query: 1 MKVEGLVSSLRNAETIEELFSILKKKGAPVIDFEGMKKLIIIEGDFEGKQFYTEINGMKA 60 MKVEGLVSSLRNAETIE+LFSILKKKGAP+ID EG+KKLII+EGDFEGKQFYTEINGMKA Sbjct: 1 MKVEGLVSSLRNAETIEDLFSILKKKGAPIIDLEGIKKLIIVEGDFEGKQFYTEINGMKA 60 Query: 61 NLVLGDAMLNSANVPFKCKKPFTGGNLILVDFDNVESEEFVLAYKNETGVYFHVKNGEPR 120 NL LGDAMLNSANVPFKCKKPFTGGNLILVD N+ES+EFVLAY+++ GVYFHVK GE + Sbjct: 61 NLALGDAMLNSANVPFKCKKPFTGGNLILVDLTNIESKEFVLAYRDDVGVYFHVKEGEAK 120 Query: 121 EISREEYEELKDKMPEFKVKGLSEEEAESMGAFFG 155 EIS+EEY+ LK+KMPEF VKGLSEEEAESMGAFFG Sbjct: 121 EISKEEYDNLKNKMPEFIVKGLSEEEAESMGAFFG 155 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.315 0.137 0.378 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58307941 Number of Sequences: 2977 Number of extensions: 2512975 Number of successful extensions: 5716 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5714 Number of HSP's gapped (non-prelim): 2 length of query: 155 length of database: 189,106,746 effective HSP length: 56 effective length of query: 99 effective length of database: 155,591,474 effective search space: 15403555926 effective search space used: 15403555926 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (21.9 bits) S2: 161 (67.1 bits)