BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1754 (PAB1754) DE:Hypothetical protein (135 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A75139 hypothetical protein PAB1754 - Pyrococcus abyssi (st... 266 9e-71 >pir||A75139 hypothetical protein PAB1754 - Pyrococcus abyssi (strain Orsay) >gi|5458337|emb|CAB49826.1| (AJ248285) hypothetical protein [Pyrococcus abyssi] Length = 135 Score = 266 bits (672), Expect = 9e-71 Identities = 135/135 (100%), Positives = 135/135 (100%) Query: 1 MGMYVVTKRKATRGNPTKIISVRIPEFVDRQIEALVELGLFKDRSDFINYALQKVLFEMF 60 MGMYVVTKRKATRGNPTKIISVRIPEFVDRQIEALVELGLFKDRSDFINYALQKVLFEMF Sbjct: 1 MGMYVVTKRKATRGNPTKIISVRIPEFVDRQIEALVELGLFKDRSDFINYALQKVLFEMF 60 Query: 61 DKIVIYPSEDVIELVLSQEPNTPPAEEELREVIENVEREVNSKFAGSGSDRFKRRRVLRV 120 DKIVIYPSEDVIELVLSQEPNTPPAEEELREVIENVEREVNSKFAGSGSDRFKRRRVLRV Sbjct: 61 DKIVIYPSEDVIELVLSQEPNTPPAEEELREVIENVEREVNSKFAGSGSDRFKRRRVLRV 120 Query: 121 RRADSGSNDRDEAVE 135 RRADSGSNDRDEAVE Sbjct: 121 RRADSGSNDRDEAVE 135 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.318 0.137 0.369 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45750197 Number of Sequences: 2977 Number of extensions: 1746023 Number of successful extensions: 6570 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6569 Number of HSP's gapped (non-prelim): 1 length of query: 135 length of database: 189,106,746 effective HSP length: 57 effective length of query: 78 effective length of database: 154,992,987 effective search space: 12089452986 effective search space used: 12089452986 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)