BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1770 (PAB1770) DE:Hypothetical protein (117 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G75135 hypothetical protein PAB1770 - Pyrococcus abyssi (st... 231 1e-60 pir||B71074 hypothetical protein PH1285 - Pyrococcus horikoshii ... 159 1e-38 >pir||G75135 hypothetical protein PAB1770 - Pyrococcus abyssi (strain Orsay) >gi|5458311|emb|CAB49800.1| (AJ248285) hypothetical protein [Pyrococcus abyssi] Length = 117 Score = 231 bits (584), Expect = 1e-60 Identities = 117/117 (100%), Positives = 117/117 (100%) Query: 1 MGAILEGFYLTILGVAIVFLVLSILAVVMYGIGEFERRSKREVETKEVKEEREEEEKVET 60 MGAILEGFYLTILGVAIVFLVLSILAVVMYGIGEFERRSKREVETKEVKEEREEEEKVET Sbjct: 1 MGAILEGFYLTILGVAIVFLVLSILAVVMYGIGEFERRSKREVETKEVKEEREEEEKVET 60 Query: 61 LEKEEDERVAVITAAILAYLSQRVPKEVPIKVKPSQNWWLSSLTREIDEIENFNYRW 117 LEKEEDERVAVITAAILAYLSQRVPKEVPIKVKPSQNWWLSSLTREIDEIENFNYRW Sbjct: 61 LEKEEDERVAVITAAILAYLSQRVPKEVPIKVKPSQNWWLSSLTREIDEIENFNYRW 117 >pir||B71074 hypothetical protein PH1285 - Pyrococcus horikoshii >gi|3257705|dbj|BAA30388.1| (AP000005) 108aa long hypothetical protein [Pyrococcus horikoshii] Length = 108 Score = 159 bits (397), Expect = 1e-38 Identities = 82/116 (70%), Positives = 94/116 (80%), Gaps = 8/116 (6%) Query: 1 MGAILEGFYLTILGVAIVFLVLSILAVVMYGIGEFERRSKREVETKEVKEEREEEEKVET 60 MGA+LEG Y+TILGV IVF+VLSILA VMYGIGEFERR+ V +E++ EE E Sbjct: 1 MGALLEGLYITILGVTIVFIVLSILAAVMYGIGEFERRT--------VGKEKKPEEVKEV 52 Query: 61 LEKEEDERVAVITAAILAYLSQRVPKEVPIKVKPSQNWWLSSLTREIDEIENFNYR 116 + E+ E+VAVITAAIL YLS+R PKEVPIKVKPS NWWLSSLTREI+EIENFNYR Sbjct: 53 EKTEDYEKVAVITAAILTYLSKRTPKEVPIKVKPSHNWWLSSLTREIEEIENFNYR 108 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.316 0.135 0.374 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40101909 Number of Sequences: 2977 Number of extensions: 1570508 Number of successful extensions: 41732 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 41727 Number of HSP's gapped (non-prelim): 2 length of query: 117 length of database: 189,106,746 effective HSP length: 56 effective length of query: 61 effective length of database: 155,591,474 effective search space: 9491079914 effective search space used: 9491079914 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.6 bits) S2: 160 (66.7 bits)