BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1823 (PAB1823) DE:Hypothetical protein (142 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D75126 hypothetical protein PAB1823 - Pyrococcus abyssi (st... 279 8e-75 pir||E71005 hypothetical protein PH1339 - Pyrococcus horikoshii ... 183 6e-46 >pir||D75126 hypothetical protein PAB1823 - Pyrococcus abyssi (strain Orsay) >gi|5458236|emb|CAB49725.1| (AJ248285) hypothetical protein [Pyrococcus abyssi] Length = 142 Score = 279 bits (707), Expect = 8e-75 Identities = 142/142 (100%), Positives = 142/142 (100%) Query: 1 MIKLKAQISIDFLIALTLITITAVNLISLGLSQMKDAETFDTSSKLKVFAIDVRDTVAKV 60 MIKLKAQISIDFLIALTLITITAVNLISLGLSQMKDAETFDTSSKLKVFAIDVRDTVAKV Sbjct: 1 MIKLKAQISIDFLIALTLITITAVNLISLGLSQMKDAETFDTSSKLKVFAIDVRDTVAKV 60 Query: 61 YSSGRGFKIRKSWPFNLGPGDNITIALQTPGMLNITAFIGGEKYIVIEKLQVPITQNTSV 120 YSSGRGFKIRKSWPFNLGPGDNITIALQTPGMLNITAFIGGEKYIVIEKLQVPITQNTSV Sbjct: 61 YSSGRGFKIRKSWPFNLGPGDNITIALQTPGMLNITAFIGGEKYIVIEKLQVPITQNTSV 120 Query: 121 ILQINSPDFWIENDGGSIRVEK 142 ILQINSPDFWIENDGGSIRVEK Sbjct: 121 ILQINSPDFWIENDGGSIRVEK 142 >pir||E71005 hypothetical protein PH1339 - Pyrococcus horikoshii >gi|3257762|dbj|BAA30445.1| (AP000006) 140aa long hypothetical protein [Pyrococcus horikoshii] Length = 140 Score = 183 bits (461), Expect = 6e-46 Identities = 86/141 (60%), Positives = 117/141 (81%), Gaps = 1/141 (0%) Query: 1 MIKLKAQISIDFLIALTLITITAVNLISLGLSQMKDAETFDTSSKLKVFAIDVRDTVAKV 60 M +++Q+SIDFLIALTL+TITA+NLISLGL+QM++A++FD SSK+KVFAIDVRDTV KV Sbjct: 1 MSNMRSQVSIDFLIALTLVTITALNLISLGLTQMEEAKSFDLSSKVKVFAIDVRDTVTKV 60 Query: 61 YSSGRGFKIRKSWPFNLGPGDNITIALQTPGMLNITAFIGGEKYIVIEKLQVPITQNTSV 120 YS G GF ++K+WPF L PGD I ++L+T G++N+T GG++Y VIE+LQVPI +N+SV Sbjct: 61 YSCGEGFAVKKTWPFELNPGDEIIVSLETSGIVNVTLITGGKRYTVIERLQVPIAENSSV 120 Query: 121 ILQINSPDFWIENDGGSIRVE 141 IL +FWI+ +GG ++VE Sbjct: 121 ILTTEKRNFWIKFEGG-VKVE 140 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.320 0.138 0.386 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48722351 Number of Sequences: 2977 Number of extensions: 1809159 Number of successful extensions: 3686 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3684 Number of HSP's gapped (non-prelim): 2 length of query: 142 length of database: 189,106,746 effective HSP length: 55 effective length of query: 87 effective length of database: 156,189,961 effective search space: 13588526607 effective search space used: 13588526607 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 161 (67.1 bits)