BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1837 747558 747226 -111 !not a gene! (111 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F71007 hypothetical protein PH1356 - Pyrococcus horikoshii ... 133 6e-31 >pir||F71007 hypothetical protein PH1356 - Pyrococcus horikoshii >gi|3257779|dbj|BAA30462.1| (AP000006) 111aa long hypothetical protein [Pyrococcus horikoshii] Length = 111 Score = 133 bits (332), Expect = 6e-31 Identities = 64/111 (57%), Positives = 78/111 (69%) Query: 1 MPNSALSHYWDCHGIHYLLNLLDGSHSRNSARFPYVSWNLVEGHHSYRSSFLGNPSLLCI 60 M +S L HY + HGIHYLL+LL+ HSRN+ PYV NLV+GH+ +S SL + Sbjct: 1 MSDSTLGHYRNRHGIHYLLDLLNRGHSRNATGLPYVCRNLVKGHYCNCTSLFSYSSLFRV 60 Query: 61 GNVHYHSAFDHLCESPLEPLGPLLHDYFQLVHIKHLPSMSYQVKSLYKAFP 111 G +HY+SAF HLCE+PL+PL L H+YFQLVHIK P YQVKSLYK FP Sbjct: 61 GYIHYNSAFYHLCETPLQPLSSLFHNYFQLVHIKPPPYDLYQVKSLYKVFP 111 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.323 0.139 0.468 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47284666 Number of Sequences: 2977 Number of extensions: 1918793 Number of successful extensions: 3154 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3153 Number of HSP's gapped (non-prelim): 1 length of query: 111 length of database: 189,106,746 effective HSP length: 45 effective length of query: 66 effective length of database: 162,174,831 effective search space: 10703538846 effective search space used: 10703538846 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (22.0 bits) S2: 160 (66.7 bits)