BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1863 708617 708168 -150 !not a gene! (150 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H71012 hypothetical protein PH1398 - Pyrococcus horikoshii ... 158 3e-38 >pir||H71012 hypothetical protein PH1398 - Pyrococcus horikoshii >gi|3257821|dbj|BAA30504.1| (AP000006) 111aa long hypothetical protein [Pyrococcus horikoshii] Length = 111 Score = 158 bits (396), Expect = 3e-38 Identities = 80/111 (72%), Positives = 85/111 (76%) Query: 13 IYLPISYMNSLAVSGLFSFLSMSRILSKKGTMYFSNSMYLSLGTKMFPILFIPFXXXXXX 72 +YLPISYMNSLAV GL SF S+ LSKKG MYFSNS+YLS GTKMFPILF PF Sbjct: 1 MYLPISYMNSLAVKGLLSFSSILSTLSKKGIMYFSNSIYLSFGTKMFPILFTPFFLSSAS 60 Query: 73 XXXXXPRMKGFNVFMKSSSMPPAVVTITSTFLSFTSQAIISLKPEDTMLDV 123 PRMKGFN FMKSSS PPAVVTITSTF S TSQA+ISL+PED M DV Sbjct: 61 STSQSPRMKGFNDFMKSSSTPPAVVTITSTFFSLTSQAMISLRPEDIMFDV 111 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.327 0.137 0.393 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37782559 Number of Sequences: 2977 Number of extensions: 1075077 Number of successful extensions: 2883 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2882 Number of HSP's gapped (non-prelim): 1 length of query: 150 length of database: 189,106,746 effective HSP length: 54 effective length of query: 96 effective length of database: 156,788,448 effective search space: 15051691008 effective search space used: 15051691008 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 161 (67.1 bits)