BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1878 692625 692296 -110 !not a gene! (110 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||C71015 hypothetical protein PH1417 - Pyrococcus horikoshii ... 125 1e-28 >pir||C71015 hypothetical protein PH1417 - Pyrococcus horikoshii >gi|3257840|dbj|BAA30523.1| (AP000006) 101aa long hypothetical protein [Pyrococcus horikoshii] Length = 101 Score = 125 bits (311), Expect = 1e-28 Identities = 65/101 (64%), Positives = 73/101 (71%) Query: 10 IACSRNSWAYLGRFXXXXXXXXXXXXXXPRIGTTLLTLFSFMFSSRYFIAQGFISQAKTN 69 +ACSRN AY GRF +IG TLF+FMFSS+YF+AQGFISQAKT Sbjct: 1 MACSRNLEAYFGRFIMILSALTHTLVTSLKIGIMFFTLFNFMFSSKYFMAQGFISQAKTI 60 Query: 70 SAFLAKRMEKGPTPANISNTTSPSWAILKTLILSVASLGEK 110 AF A+R+E GPTPANISNT SPS AILKTLILSVA+LGEK Sbjct: 61 LAFFARRIENGPTPANISNTISPSLAILKTLILSVANLGEK 101 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.323 0.133 0.394 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33753437 Number of Sequences: 2977 Number of extensions: 893811 Number of successful extensions: 1781 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1780 Number of HSP's gapped (non-prelim): 1 length of query: 110 length of database: 189,106,746 effective HSP length: 53 effective length of query: 57 effective length of database: 157,386,935 effective search space: 8971055295 effective search space used: 8971055295 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (22.0 bits) S2: 159 (66.3 bits)