BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1882 686158 685604 -185 !not a gene! (185 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A72741 hypothetical protein APE0458 - Aeropyrum pernix (str... 71 1e-11 >pir||A72741 hypothetical protein APE0458 - Aeropyrum pernix (strain K1) >gi|5104105|dbj|BAA79421.1| (AP000059) 160aa long hypothetical protein [Aeropyrum pernix] Length = 160 Score = 70.6 bits (170), Expect = 1e-11 Identities = 48/149 (32%), Positives = 62/149 (41%), Gaps = 3/149 (2%) Query: 39 PQPRSANPLFNASTTISFLSLVAYSFVFLSLTNSTPHANPSPLT--XXXXXXXXXXXXXX 96 P P + PL ++ + + S VF SLT+STP +P PLT Sbjct: 13 PAPITRRPLLKDLSSTQARASLWGSLVFSSLTSSTPIISPLPLTWPTILSSSAASPSIFS 72 Query: 97 XXXXXXXXWAFSIRPFWXXXXXXXXXXXXXXFPPKVLLWTPLTPKSRSALNIVAPIGIPP 156 + S+ P PPKVL W P S L AP G PP Sbjct: 73 AFSPSLCDLSHSLSPS-ITSITALKAARATGLPPKVLAWLPRGRLITSLLPTAAPSGSPP 131 Query: 157 PKAFATVIMSGTTSKCSIAHILPVLPIPI 185 P A A + SG+T +CS A+ILPVL P+ Sbjct: 132 PMALARAMTSGSTPQCSTANILPVLAKPV 160 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.324 0.136 0.433 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51937598 Number of Sequences: 2977 Number of extensions: 1568056 Number of successful extensions: 4495 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4494 Number of HSP's gapped (non-prelim): 1 length of query: 185 length of database: 189,106,746 effective HSP length: 50 effective length of query: 135 effective length of database: 159,182,396 effective search space: 21489623460 effective search space used: 21489623460 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.6 bits) S2: 163 (67.9 bits)