BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1911 640191 639760 -144 !not a gene! (144 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||C71023 hypothetical protein PH1480 - Pyrococcus horikoshii ... 133 8e-31 >pir||C71023 hypothetical protein PH1480 - Pyrococcus horikoshii >gi|3257904|dbj|BAA30587.1| (AP000006) 130aa long hypothetical protein [Pyrococcus horikoshii] Length = 130 Score = 133 bits (332), Expect = 8e-31 Identities = 69/119 (57%), Positives = 78/119 (64%) Query: 20 HFQPYWLKNFFLSLFIVPDTPRVLMISLLPLKSVASIRANLKCSTYSLSHLTIPVFVFGS 79 HF PY+ KNF SLFIVP+TP VL+ISLLPL S SI ANL+ STYS SHLTIPVFV GS Sbjct: 5 HFHPYFAKNFLFSLFIVPETPSVLIISLLPLNSETSINANLRYSTYSRSHLTIPVFVLGS 64 Query: 80 YFMNHGLANAVPSSPRTLSEASHIRXXXXXXXXXXXXXXXKAMYLFLSLSVGGKVLSFI 138 F++ GL AVP SP T E H+ AMYLFLSL VGG+V SF+ Sbjct: 65 NFISQGLTIAVPVSPSTSKELFHMSSLTSSFVKSPSLIISNAMYLFLSLRVGGRVFSFL 123 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.327 0.138 0.422 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38792378 Number of Sequences: 2977 Number of extensions: 1088885 Number of successful extensions: 2732 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2731 Number of HSP's gapped (non-prelim): 1 length of query: 144 length of database: 189,106,746 effective HSP length: 50 effective length of query: 94 effective length of database: 159,182,396 effective search space: 14963145224 effective search space used: 14963145224 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 161 (67.1 bits)