BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1915 637300 636896 -135 !not a gene! (135 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A71024 hypothetical protein PH1486 - Pyrococcus horikoshii ... 116 9e-26 >pir||A71024 hypothetical protein PH1486 - Pyrococcus horikoshii >gi|3257910|dbj|BAA30593.1| (AP000006) 125aa long hypothetical protein [Pyrococcus horikoshii] Length = 125 Score = 116 bits (289), Expect = 9e-26 Identities = 54/94 (57%), Positives = 66/94 (69%) Query: 35 VTWSVNDRDVPVWGLELGVSNVDGDTPFSLLLKPVHDPSEXXXXXXXXXXXXXXXXXXWD 94 +T S++D +VPVW +LGVSN+D +T FSL LKP+HDPSE W+ Sbjct: 1 MTRSIDDGNVPVWSFKLGVSNIDRNTSFSLFLKPIHDPSELEGLTLFAHLLELLDDCLWN 60 Query: 95 VPGVVEEPSDGRALSVVYVSDKHDVNVGLLLWHL 128 VP +++EPSD RALSVVYV DKHDVNVGLLLWHL Sbjct: 61 VPSIIKEPSDCRALSVVYVPDKHDVNVGLLLWHL 94 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.317 0.139 0.454 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52378755 Number of Sequences: 2977 Number of extensions: 1913569 Number of successful extensions: 3100 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3098 Number of HSP's gapped (non-prelim): 1 length of query: 135 length of database: 189,106,746 effective HSP length: 47 effective length of query: 88 effective length of database: 160,977,857 effective search space: 14166051416 effective search space used: 14166051416 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.6 bits) S2: 161 (67.1 bits)