BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1949 577023 576652 -124 !not a gene! (124 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB57570.1| (Y18930) hypothetical protein [Sulfolobus solfat... 73 1e-12 >emb|CAB57570.1| (Y18930) hypothetical protein [Sulfolobus solfataricus] Length = 107 Score = 73.0 bits (176), Expect = 1e-12 Identities = 42/74 (56%), Positives = 50/74 (66%) Query: 1 MSSSLLRSRTISPSILPAAHAATRSLIGIPASAKAKEAAVIPATLVPASAWRTSMKTSIA 60 +SS +SR I+PS P A A +SLIGIPASA AKEAA+ L PASA S+ TSIA Sbjct: 7 ISSVSFKSRIITPSAFPTATPAIKSLIGIPASASAKEAAINETNLDPASACNISVNTSIA 66 Query: 61 VLGNISSIKAGSRA 74 VLGN S+ A S+A Sbjct: 67 VLGNSSTKTADSKA 80 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.317 0.127 0.357 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31571230 Number of Sequences: 2977 Number of extensions: 829716 Number of successful extensions: 3151 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3150 Number of HSP's gapped (non-prelim): 1 length of query: 124 length of database: 189,106,746 effective HSP length: 58 effective length of query: 66 effective length of database: 154,394,500 effective search space: 10190037000 effective search space used: 10190037000 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)