BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1973 (PAB1973) DE:Hypothetical protein (122 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B75177 hypothetical protein PAB1973 - Pyrococcus abyssi (st... 245 2e-64 pir||C71037 hypothetical protein PH1587 - Pyrococcus horikoshii ... 235 1e-61 >pir||B75177 hypothetical protein PAB1973 - Pyrococcus abyssi (strain Orsay) >gi|5458007|emb|CAB49497.1| (AJ248284) hypothetical protein [Pyrococcus abyssi] Length = 122 Score = 245 bits (618), Expect = 2e-64 Identities = 122/122 (100%), Positives = 122/122 (100%) Query: 1 MEPSEFKLNQKGIKAVLPSLEAEIMEYMWEIKEGTAGEVFEYLKKKHPEIRRSTVSILMN 60 MEPSEFKLNQKGIKAVLPSLEAEIMEYMWEIKEGTAGEVFEYLKKKHPEIRRSTVSILMN Sbjct: 1 MEPSEFKLNQKGIKAVLPSLEAEIMEYMWEIKEGTAGEVFEYLKKKHPEIRRSTVSILMN 60 Query: 61 RLCEKGLLTRRMDRGRGGIRYIYTITTTREEFERKVVEKIIDSLLANFREATYAYLAKKI 120 RLCEKGLLTRRMDRGRGGIRYIYTITTTREEFERKVVEKIIDSLLANFREATYAYLAKKI Sbjct: 61 RLCEKGLLTRRMDRGRGGIRYIYTITTTREEFERKVVEKIIDSLLANFREATYAYLAKKI 120 Query: 121 KK 122 KK Sbjct: 121 KK 122 >pir||C71037 hypothetical protein PH1587 - Pyrococcus horikoshii >gi|3258016|dbj|BAA30699.1| (AP000006) 122aa long hypothetical protein [Pyrococcus horikoshii] Length = 122 Score = 235 bits (594), Expect = 1e-61 Identities = 113/122 (92%), Positives = 122/122 (99%) Query: 1 MEPSEFKLNQKGIKAVLPSLEAEIMEYMWEIKEGTAGEVFEYLKKKHPEIRRSTVSILMN 60 MEPSEFKLNQKGIK+VLP+LEAEIMEYMW+IKEGTAGEV+EYLK+KHPEIRRSTVSILMN Sbjct: 1 MEPSEFKLNQKGIKSVLPALEAEIMEYMWKIKEGTAGEVYEYLKQKHPEIRRSTVSILMN 60 Query: 61 RLCEKGLLTRRMDRGRGGIRYIYTITTTREEFERKVVEKIIDSLLANFREATYAYLAKKI 120 RLCEKGLLTRRMDRGRGGI+YIYT+TTTREEFERK+VEKIIDSL+ANFREATYAYLAKKI Sbjct: 61 RLCEKGLLTRRMDRGRGGIKYIYTVTTTREEFERKIVEKIIDSLIANFREATYAYLAKKI 120 Query: 121 KK 122 KK Sbjct: 121 KK 122 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.319 0.136 0.378 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40471486 Number of Sequences: 2977 Number of extensions: 1423037 Number of successful extensions: 4044 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4042 Number of HSP's gapped (non-prelim): 2 length of query: 122 length of database: 189,106,746 effective HSP length: 55 effective length of query: 67 effective length of database: 156,189,961 effective search space: 10464727387 effective search space used: 10464727387 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)