BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1986 533861 533253 -203 !not a gene! (203 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||C71039 hypothetical protein PH1603 - Pyrococcus horikoshii ... 180 2e-44 >pir||C71039 hypothetical protein PH1603 - Pyrococcus horikoshii >gi|3258032|dbj|BAA30715.1| (AP000006) 163aa long hypothetical protein [Pyrococcus horikoshii] Length = 163 Score = 180 bits (451), Expect = 2e-44 Identities = 89/160 (55%), Positives = 107/160 (66%), Gaps = 1/160 (0%) Query: 13 MPWWKRPSCTLPVDYNFNLLPXXXXXXXXXXXXXXXXXYAHPEV-LWVLPKYLLEALPNP 71 MP WK P T PVDYNFN LP Y H +V L +L K+ LEA P+P Sbjct: 1 MPRWKCPRSTFPVDYNFNPLPIHFVFFNLTNIVSNIVNYIHAQVSLGILFKHFLEAFPDP 60 Query: 72 VCYHLPVGPGEVSSRLHSREVPLPFFTLERNAYKLSIWPWNPVLPYRPLHYPEIITRNLV 131 + YHLP+ P +VSS HS EVPLP FTLE NAY+L IWP P+L Y PLHYP++IT NL+ Sbjct: 61 MRYHLPICPSKVSSCFHSTEVPLPLFTLEGNAYQLPIWPRYPILSYGPLHYPKVITCNLM 120 Query: 132 TETSRTCVNHNDDLTLEEPVDLCHLRIKYLVNDLNFKEVI 171 ++ SR+ VNH+D+LT EEPV H RIKYL+N LN KEVI Sbjct: 121 SKPSRSRVNHDDNLTFEEPVSFSHFRIKYLINYLNLKEVI 160 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.324 0.143 0.497 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76030554 Number of Sequences: 2977 Number of extensions: 2879998 Number of successful extensions: 4471 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4469 Number of HSP's gapped (non-prelim): 1 length of query: 203 length of database: 189,106,746 effective HSP length: 44 effective length of query: 159 effective length of database: 162,773,318 effective search space: 25880957562 effective search space used: 25880957562 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (22.0 bits) S2: 163 (67.9 bits)